KEGG   Thermotoga naphthophila: Tnap_1164Help
Entry
Tnap_1164         CDS       T01139                                 

Definition
aspartate carbamoyltransferase
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tnp  Thermotoga naphthophila
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tnp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tnp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1193090..1194673)
Genome map
AA seq 527 aa AA seqDB search
MKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKQRWYNGEDVSDFRIKKRNVGIYIVFVEP
STRTKESFINAAKFHSGPNVKVNVFDSEHSSFNKQESYTDTFSMLTGYSDYSIFVVRTRL
EGVCRLLERRISEFASRNGIEVPSFINAGDGKHEHPTQELLDEYTFLEQNGFDNSFIHVA
LVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYVEKMKKNGFEVRIFSSIREY
LSQKDVAKIWYFTRLQLERMGEDILEKVHILREAVTFKKEYLDALPEGVKFYHPLPRHKV
YPTIPNFLDTLPLNGWETQARNGYWVRIVLLSMFGGALEAPFDTSKKEEKPEEDFIIPAP
ITHGSKGVQKEGKRGIKPIENGTVIDHIAKGKTPEEIYSTIVKIRKILRLYDVDSADGIF
RSSDGNFKGYISLPDRYLSKREIKKLSAISPNTTVNIIKNSTVVEKYRIKLPPTIYGFEE
LRCKNENCITNPAHGENASPSFVRDEKGQFICEYCETPHSFEEIWSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggattttctcggcagaaccctcgcagtcatagaagatctgagcgtggaggag
cagatgttcctctatgagaaaaccagagagctcaaacagagatggtacaacggagaggat
gtatcggatttcaggataaagaagagaaacgttggaatatacatcgttttcgttgaacca
agcacgaggacgaaagaatccttcataaacgctgcaaagtttcactcgggtccaaacgtg
aaggtgaacgttttcgattcggaacattcctccttcaacaaacaagaaagctacacggac
accttctccatgctcacaggctacagcgactactccatattcgttgtgagaacaagactc
gaaggagtctgtagactcctggaaagaagaatatcagaattcgcaagcaggaacggtata
gaagtaccctcttttataaacgcgggcgacggaaagcacgagcatccaacacaggaactt
ctggatgaatacacctttctcgagcagaatggttttgacaactcgttcatacatgtggca
ctcgttggtgacctgcttcacggccgaacggttcattccaaagtgaacggcttgaagata
ttcaaaaatgtgaaggtggatcttgtggcaccggaagagctcatgatgccagagcattac
gtagaaaagatgaaaaagaacggtttcgaggtcaggattttctcttcgatcagagagtat
ctcagccagaaagatgtggcaaagatctggtacttcacacggcttcaactcgaaagaatg
ggagaagacattctcgagaaggttcatattctgagagaagcagtcactttcaaaaaagag
tatctggacgcactgccggaaggagtgaagttctaccatccgcttccaaggcacaaggtt
tatccgacgataccgaacttcctggacacactccctctgaacggatgggaaacacaggcg
aggaacggttactgggtgaggatcgtgcttctttccatgttcggtggagcgctggaagca
cctttcgatacctcgaagaaagaagaaaagccagaagaagacttcataatccctgctccc
atcacacacggatcaaagggggttcaaaaggaaggaaaaagaggtataaaacccattgaa
aacggaacggtgatagaccacatagccaaaggaaagacaccggaggaaatttactcaaca
attgtgaaaataaggaaaattctgagactctacgatgtggacagtgcggatggtattttc
cggtcgagtgatggaaacttcaagggctacatcagcctgccggatcgttatctctccaag
agagaaataaaaaaactctcggcgatttctccaaacaccacagtcaacatcataaaaaac
agcacggttgttgaaaaatacagaataaagcttccaccaacgatctatggatttgaggaa
ctccgatgcaaaaacgagaactgcatcaccaatcccgcacacggcgaaaatgcttcacct
tcctttgtgagagacgaaaaaggacagtttatatgcgagtactgtgaaacaccgcattct
ttcgaagaaatctggagtatttga

DBGET integrated database retrieval system