KEGG   Thermotoga naphthophila: Tnap_1164Help
Entry
Tnap_1164         CDS       T01139                                 

Definition
aspartate carbamoyltransferase
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tnp  Thermotoga naphthophila
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tnap_1164
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tnap_1164
Enzymes [BR:tnp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tnap_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1193090..1194673)
Genome map
AA seq 527 aa AA seqDB search
MKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKQRWYNGEDVSDFRIKKRNVGIYIVFVEP
STRTKESFINAAKFHSGPNVKVNVFDSEHSSFNKQESYTDTFSMLTGYSDYSIFVVRTRL
EGVCRLLERRISEFASRNGIEVPSFINAGDGKHEHPTQELLDEYTFLEQNGFDNSFIHVA
LVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYVEKMKKNGFEVRIFSSIREY
LSQKDVAKIWYFTRLQLERMGEDILEKVHILREAVTFKKEYLDALPEGVKFYHPLPRHKV
YPTIPNFLDTLPLNGWETQARNGYWVRIVLLSMFGGALEAPFDTSKKEEKPEEDFIIPAP
ITHGSKGVQKEGKRGIKPIENGTVIDHIAKGKTPEEIYSTIVKIRKILRLYDVDSADGIF
RSSDGNFKGYISLPDRYLSKREIKKLSAISPNTTVNIIKNSTVVEKYRIKLPPTIYGFEE
LRCKNENCITNPAHGENASPSFVRDEKGQFICEYCETPHSFEEIWSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggattttctcggcagaaccctcgcagtcatagaagatctgagcgtggaggag
cagatgttcctctatgagaaaaccagagagctcaaacagagatggtacaacggagaggat
gtatcggatttcaggataaagaagagaaacgttggaatatacatcgttttcgttgaacca
agcacgaggacgaaagaatccttcataaacgctgcaaagtttcactcgggtccaaacgtg
aaggtgaacgttttcgattcggaacattcctccttcaacaaacaagaaagctacacggac
accttctccatgctcacaggctacagcgactactccatattcgttgtgagaacaagactc
gaaggagtctgtagactcctggaaagaagaatatcagaattcgcaagcaggaacggtata
gaagtaccctcttttataaacgcgggcgacggaaagcacgagcatccaacacaggaactt
ctggatgaatacacctttctcgagcagaatggttttgacaactcgttcatacatgtggca
ctcgttggtgacctgcttcacggccgaacggttcattccaaagtgaacggcttgaagata
ttcaaaaatgtgaaggtggatcttgtggcaccggaagagctcatgatgccagagcattac
gtagaaaagatgaaaaagaacggtttcgaggtcaggattttctcttcgatcagagagtat
ctcagccagaaagatgtggcaaagatctggtacttcacacggcttcaactcgaaagaatg
ggagaagacattctcgagaaggttcatattctgagagaagcagtcactttcaaaaaagag
tatctggacgcactgccggaaggagtgaagttctaccatccgcttccaaggcacaaggtt
tatccgacgataccgaacttcctggacacactccctctgaacggatgggaaacacaggcg
aggaacggttactgggtgaggatcgtgcttctttccatgttcggtggagcgctggaagca
cctttcgatacctcgaagaaagaagaaaagccagaagaagacttcataatccctgctccc
atcacacacggatcaaagggggttcaaaaggaaggaaaaagaggtataaaacccattgaa
aacggaacggtgatagaccacatagccaaaggaaagacaccggaggaaatttactcaaca
attgtgaaaataaggaaaattctgagactctacgatgtggacagtgcggatggtattttc
cggtcgagtgatggaaacttcaagggctacatcagcctgccggatcgttatctctccaag
agagaaataaaaaaactctcggcgatttctccaaacaccacagtcaacatcataaaaaac
agcacggttgttgaaaaatacagaataaagcttccaccaacgatctatggatttgaggaa
ctccgatgcaaaaacgagaactgcatcaccaatcccgcacacggcgaaaatgcttcacct
tcctttgtgagagacgaaaaaggacagtttatatgcgagtactgtgaaacaccgcattct
ttcgaagaaatctggagtatttga

DBGET integrated database retrieval system