KEGG   Thermotoga naphthophila: Tnap_1340Help
Entry
Tnap_1340         CDS       T01139                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00010  Glycolysis / Gluconeogenesis
tnp00052  Galactose metabolism
tnp00500  Starch and sucrose metabolism
tnp00520  Amino sugar and nucleotide sugar metabolism
tnp00521  Streptomycin biosynthesis
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01120  Microbial metabolism in diverse environments
tnp01130  Biosynthesis of antibiotics
tnp01200  Carbon metabolism
Module
tnp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_1340
   00052 Galactose metabolism
    Tnap_1340
   00500 Starch and sucrose metabolism
    Tnap_1340
   00520 Amino sugar and nucleotide sugar metabolism
    Tnap_1340
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tnap_1340
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tnap_1340
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tnap_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADA67425
JGI: Tnap_1340
UniProt: D2C3X1
Position
1342374..1343318
Genome map
AA seq 314 aa AA seqDB search
MKLIGVDLGGTTFSVGLVSEDGKILKKVTRDTLVENGKEDVIRRIAEAILEVADGEETPY
VGIGSPGSIDRENGIVRFSPNFPDWHNVPLTDELAKRTGKKVFLENDANAFVLGEKWFGA
GRGYDHIVALTLGTGIGGGVVTHGHLLTGRDGIGAELGHVVVEPNGPMCNCGTRGCLEAV
SSATAIRRFLREGYKKYHDSLVYKLAGSPEKADAKHLFDAARQGDRFALMIRDRVVDALA
RAVAGYIHIFNPEIVIIGGGISRAGEILFGPLREKVVDYIMPSFVGTYEIVASPLVEDAG
ILGAASIIKERIGG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctcataggagttgatcttggaggaactaccttctcggtaggactcgtgagtgaa
gatggaaaaatactgaagaaagtaactcgggatactctcgtagagaacggaaaagaagat
gtgataagaagaatcgccgaagcgattctggaggtggctgatggagaagaaacgccttac
gttggcattggatctccaggttcgatagatagagagaatgggattgtcagattctcccct
aattttccggactggcacaacgttccactaactgatgagctggcaaagagaactgggaag
aaagtttttcttgaaaacgatgcgaacgcgtttgtccttggagagaagtggttcggagcc
ggaagaggatacgatcacatagtggctctgacacttggaactggcattggcggaggagtt
gtcactcacggacacctcctcacgggaagggatggaataggagcggaactcgggcatgtt
gtcgtcgaacccaatggccccatgtgcaactgcggtacaaggggttgtcttgaagctgtg
tcatccgcaacggcgataaggagatttctcagagaaggctacaagaaatatcacgactct
ctggtttacaaactcgcgggttcacccgaaaaggcagacgccaagcacctttttgacgcc
gcaagacagggagacagattcgctctgatgataagagacagggtggtggatgccctggca
cgagccgtagcgggctacatacacatattcaacccggagatagtgatcataggtggagga
atttcaagagcgggagagattctgtttggtcccctgagagagaaagtggtggattacatc
atgccatcctttgtgggaacctacgaaatagtggcgagccctctcgtcgaagacgccgga
atcctcggagcggcttccataataaaggagaggataggggggtga

DBGET integrated database retrieval system