KEGG   Thermotoga naphthophila: Tnap_1715Help
Entry
Tnap_1715         CDS       T01139                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tnp  Thermotoga naphthophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Metallophos_3 Peptidase_M18 Imm59
Motif
Other DBs
NCBI-ProteinID: ADA67782
JGI: Tnap_1715
UniProt: D2C4X8
Position
complement(1707468..1708463)
Genome map
AA seq 331 aa AA seqDB search
MKELIRKLTEAFGPSGREEEVRRIILEELEGYIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNIDEKGFLTIEPVGGVSPYMLLGKRIRFENGVVGVVGMEGETTEERQENVR
KLSFDKLFVDIGASSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPTVTLYGVFSVQEEVGLVGASVAGYGISADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSRRILENLIEIAEKFSIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
VPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactgatcagaaagctgacggaagccttcggtccgagtggacgggaagaagag
gtgagaagaatcatcctcgaagaactcgaagggtacatagatggtcacagaatcgatggg
ctcggcaatctcatagtttggaaaggaagcggtgagaagaaggtgatactggacgctcac
atagatgagataggtgttgttgttacaaacatagatgaaaaaggatttctgacgatagaa
cccgtcggtggtgtctctccgtacatgcttcttggaaaaaggatcaggttcgaaaacggt
gtggtaggcgttgttggtatggaaggtgaaacaacagaagaaaggcaggagaatgtgaga
aagctctcgttcgacaagctgttcgttgacatcggtgcaagttcccgggaggaagcacag
aagatgtgcccgattggaagtttcggcgtctacgacagtggattcgttgaagtttccgga
aaatacgtctcgaaggcgatggacgacaggataggatgcgccgtaatcgtcgaagttttc
aaaagaatcaaacccactgttacgctctacggtgttttcagtgttcaggaagaagtggga
ttggttggtgcctcggtggcaggctacggcatatcagcggatgaggccattgcgatcgat
gtgacagattcggcagatacaccgaaggccataaagagacacgctatgagactctccggt
ggtcccgctttgaaagtcaaagacagagcctcgatcagcagcagacgcatcctcgaaaat
ctgatagagatcgcggaaaagttcagtataaagtatcagatggaagttctgacgttcggt
ggcacgaacgccatgggatatcaacgaacaagagaaggaattccttccgccacggtgtct
gttcccacacgatacgttcattcacccagtgagatgatcgcaccggatgatgttgaggca
acggtcgatcttctcatcaggtatctgggggcgtga

DBGET integrated database retrieval system