KEGG   Thermotoga naphthophila: Tnap_1715Help
Entry
Tnap_1715         CDS       T01139                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tnp  Thermotoga naphthophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1707468..1708463)
Genome map
AA seq 331 aa AA seqDB search
MKELIRKLTEAFGPSGREEEVRRIILEELEGYIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNIDEKGFLTIEPVGGVSPYMLLGKRIRFENGVVGVVGMEGETTEERQENVR
KLSFDKLFVDIGASSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPTVTLYGVFSVQEEVGLVGASVAGYGISADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSRRILENLIEIAEKFSIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
VPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactgatcagaaagctgacggaagccttcggtccgagtggacgggaagaagag
gtgagaagaatcatcctcgaagaactcgaagggtacatagatggtcacagaatcgatggg
ctcggcaatctcatagtttggaaaggaagcggtgagaagaaggtgatactggacgctcac
atagatgagataggtgttgttgttacaaacatagatgaaaaaggatttctgacgatagaa
cccgtcggtggtgtctctccgtacatgcttcttggaaaaaggatcaggttcgaaaacggt
gtggtaggcgttgttggtatggaaggtgaaacaacagaagaaaggcaggagaatgtgaga
aagctctcgttcgacaagctgttcgttgacatcggtgcaagttcccgggaggaagcacag
aagatgtgcccgattggaagtttcggcgtctacgacagtggattcgttgaagtttccgga
aaatacgtctcgaaggcgatggacgacaggataggatgcgccgtaatcgtcgaagttttc
aaaagaatcaaacccactgttacgctctacggtgttttcagtgttcaggaagaagtggga
ttggttggtgcctcggtggcaggctacggcatatcagcggatgaggccattgcgatcgat
gtgacagattcggcagatacaccgaaggccataaagagacacgctatgagactctccggt
ggtcccgctttgaaagtcaaagacagagcctcgatcagcagcagacgcatcctcgaaaat
ctgatagagatcgcggaaaagttcagtataaagtatcagatggaagttctgacgttcggt
ggcacgaacgccatgggatatcaacgaacaagagaaggaattccttccgccacggtgtct
gttcccacacgatacgttcattcacccagtgagatgatcgcaccggatgatgttgaggca
acggtcgatcttctcatcaggtatctgggggcgtga

DBGET integrated database retrieval system