KEGG   Thermotoga naphthophila: Tnap_1716Help
Entry
Tnap_1716         CDS       T01139                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
tnp  Thermotoga naphthophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1708460..1709479)
Genome map
AA seq 339 aa AA seqDB search
MYLKELSMMPGVSGDEGKVRDFIRSKIEGLVDNLYTDVLGNLIALKRGRDSSKKLLVSAH
MDEVGFVVSKIEKDGKVAFLPIGGVDSRILPGKVVQVKDLKGVIGYRPIHLQRDEENTPP
RFENLRIDFGFSSADEAKKYVSIGDYVSFVSDYIEKNGRAVGKAFDDRAGCSVLIDVLES
GVSPAYDTYFVFTVQEETGLRGSAVVVEQLKPTCAIVVETTTAGDNPELEERKWATHLGD
GPAITFFHRGYVIPKEIFQTIVDTAKNNDIPFQMKRRTAGGTDAGRYARTAYGVPAGVIS
TPARYIHSPNSIIDLNDYENTKKLIKVLVEEGKIVEVVS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcaaagagctttcgatgatgccgggtgtgtctggagatgaaggaaaagttagg
gatttcataaggtcaaagatagaaggtcttgttgacaatctttacaccgatgtccttggg
aatttgatagctttgaaaagaggaagagattcttcgaaaaaactgctcgtttcggctcac
atggatgaggtcggtttcgttgtgagcaaaatagaaaaggacggaaaagtggcgttcttg
cccattggaggagtcgattccaggatacttcccggaaaggtggttcaggtgaaggatctc
aaaggagttatcggctacagaccgatccaccttcagcgcgatgaagagaacactccccca
aggtttgagaatctgagaattgattttggtttttcttctgcagacgaagcgaaaaagtac
gtatcaataggagactacgtctctttcgtgagtgattacatcgaaaagaacggccgggca
gtcgggaaagcgttcgacgacagagcggggtgttctgttctgatcgatgttctcgaaagc
ggtgtgagtcctgcctacgatacgtactttgtcttcacagttcaggaagagacgggactt
cgtggaagtgcagttgtggtggaacagctgaaacccacctgtgccatcgtcgtggaaacc
accacggccggcgacaatccggaactggaggaaaggaaatgggcaacacatctgggtgac
ggtcctgccatcaccttttttcacaggggatacgtgatcccaaaggagatctttcaaact
atcgtggatacagcgaagaacaacgacattccgtttcagatgaagagaagaaccgctggg
ggaacggacgcgggacgttacgccagaaccgcctacggagtgccagcaggtgtgatctcc
actccagcacggtacatccacagtccgaattcgatcatagatttgaacgactacgaaaac
acgaagaaactcataaaagtacttgtcgaggaaggaaaaatcgtggaggtggtctcatga

DBGET integrated database retrieval system