KEGG   Thermotoga naphthophila: Tnap_1723Help
Entry
Tnap_1723         CDS       T01139                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tnp  Thermotoga naphthophila
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tnap_1723
  Amino acid metabolism
   00340 Histidine metabolism
    Tnap_1723
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tnap_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1714964..1716250
Genome map
AA seq 428 aa AA seqDB search
MILMNNPGDKEVLRLLKQRMESVSQVEEAVKEIIRRVKEEGDRALEEFLKRFEKHPVGIE
NLRVTEKEISEAQVEEEFVETIKMVIEDLKEFHRRQEERSFFFTTKGGSFLGEMVVPLES
VGIYVPGGKVPYFSTLLMCAVPAIVAGVERIVVTTPPDENGGISPYILKTCEILGLKEIY
RMGGAHAVAALTYGTETVKPVDKIVGPGGVFVTLAKKHVYGDVGIDSIAGPSEITIVTDG
SVDLDLVAADFLSQAEHDENAMSVVITTSREVFEKLPHVIERHLEALPEERRKTARISTE
NFGTIILTDSLKRAFEISNLIAPEHLEVLVEKPFESLGYIKNAGSVFLGKYTCESVGDYG
AGPNHVLPTFRSARFSSGLRVSDFTKKIFITYLSEEDFKRKGELYSKMARWEGFEAHARA
IDVRRGKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgattttgatgaacaaccccggagataaagaagtgctcagactgttgaaacagaggatg
gaatccgtatcgcaggtggaagaggccgtaaaagagatcatcaggagagtgaaagaagaa
ggagacagagccctcgaagaattcctcaaaaggtttgagaagcacccggtgggcatcgag
aaccttcgtgtcacagagaaggaaatatcggaagcccaagtagaagaagaattcgttgaa
acgataaaaatggtgatagaagacctgaaagaattccatcgaagacaggaggaaagatct
ttctttttcacgacgaagggtggaagtttcctgggagagatggttgtccctctcgagagc
gtgggaatttacgttcctggaggaaaggttccgtacttctctacgctcctcatgtgtgcg
gttcctgctatcgtcgctggtgtggaaaggatcgtcgtcacaacaccaccagatgaaaac
ggaggcatctccccatacatcctgaaaacctgcgaaatcctcggtctgaaagagatctat
cggatgggaggagctcatgcggtggctgctctcacgtacggcacggaaacagtgaaaccc
gttgacaagatcgtgggacccggtggagtcttcgtcacgctcgcgaagaaacacgtttac
ggagacgtcggaatcgactccatagcaggtcccagtgagatcacgatcgtgacggacggt
agcgttgatctggatctcgtagccgcggattttctctcccaggcggagcacgacgagaac
gcgatgagcgtggtgataaccacctcgagagaagtcttcgaaaaattgcctcatgtcata
gaaagacacctggaagctcttccagaagagagaagaaaaacggccaggatctcaacggaa
aacttcggtaccatcatcttgacagacagtctgaaaagggcctttgagatctccaacctc
atcgctcccgaacatctggaagtcctcgtggaaaagccgtttgaatcgctgggatacata
aagaacgcgggatctgttttccttggaaagtacacctgtgagtctgtgggagactacggt
gcgggaccgaaccacgtccttcccaccttcagatccgcgagattctcctccggactcaga
gtttccgatttcacgaagaagatattcatcacgtatctctccgaagaagatttcaaaaga
aagggcgagctttactcgaagatggcacgttgggaaggttttgaagcccacgctcgggca
atagacgtcaggaggggaaaactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system