KEGG   Thermotoga naphthophila: Tnap_1790Help
Entry
Tnap_1790         CDS       T01139                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tnp  Thermotoga naphthophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tnap_1790
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tnap_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1784782..1785675
Genome map
AA seq 297 aa AA seqDB search
MISVVGSSNIDIVLKVDHFTKPGETQKALEMNIFPGGKGANQAVTVAKIGERGCYFLTCL
GNDDYARILSDNFERHGIKGCLQVNAPTGRAFIEVDRNGQNRIIIFSGANAELKKEMIDW
KALSESEILLLQNEISFETTLECAKRFNGIVIFDPAPVQGISKEIFQHVNYLTPNEEEIE
ALSREVFGEFLSIEKAAERFLELGVENVIVKLGSKGALVVNKHKKKHFPAFKVKAVDTTA
AGDVFNGAFAVGLAEGRSLEDAVIFGMAAAAISVTRLGAQSSIPSRQEVEEFLKVKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgatatcagttgttggaagttcaaacatagacatcgtcctcaaggttgatcacttcacc
aaaccgggagaaactcaaaaggcactcgagatgaacatttttcccggcggaaaaggagca
aatcaggctgtaaccgttgcaaaaataggagaaagaggctgttattttttgacatgtttg
ggaaacgacgattatgcaagaattctctcggataattttgaaaggcatggaataaaaggg
tgcctccaagtaaatgcccctaccggaagagccttcatagaggtggacaggaacggtcag
aacagaatcatcatcttttctggtgcgaatgccgaattgaagaaagagatgatcgattgg
aaagcactctctgagagtgagattcttctccttcagaacgagatctcgtttgaaaccact
ctggagtgtgcaaagaggttcaacggtatcgtaatttttgatcctgcacctgtacaggga
ataagcaaggaaatcttccagcatgtgaattatcttacgccgaacgaggaggagatcgaa
gctctttcgagggaagttttcggtgagtttttgtccatcgaaaaagccgctgaaaggttt
ttggaacttggtgtcgagaacgtgatagtgaaactcggcagcaaaggagcacttgttgtg
aacaaacataagaaaaagcattttccggctttcaaggtaaaagccgtggatacaacagca
gcaggggatgttttcaacggagccttcgctgttgggctggcagagggcagaagtcttgaa
gatgctgtgatcttcggaatggcggcagcggctatatccgtaacaaggctcggggctcaa
agttctataccctcacggcaggaagtggaagagtttttgaaggtgaaattatga

DBGET integrated database retrieval system