KEGG   Thermodesulfobium narugense: Thena_0160Help
Entry
Thena_0160        CDS       T01488                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tnr  Thermodesulfobium narugense
Brite
Enzymes [BR:tnr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Thena_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171112..171921
Genome map
AA seq 269 aa AA seqDB search
MIKDIELKSGNKRAVILFHGLTGTPFELSRFAKYLFSLKFDVFVPCLPGHCAKPSALDRV
VWQDWSYFAQDKYKMISKKYNEVFISGICLGALLCLEISRRFPVRAQALLSPTLAIDGWN
IPWYKFLLPLAFIPPFIWLYSYKESEPYGIKNESVRRQVLRIMQNKSSGVYESYSAIAIR
ELLRFSKSVKLYLKEIKTPTLVIHSTQDDLCNIKNAKDLYNKLSSKDKKFVELHDSYHMV
TLDNERDMVFKECSDFFIKYSEAVDEQDY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaagatatagaattaaaatctgggaataaaagagctgtaattttgtttcatggc
ttaacagggacgccatttgaactttcaaggtttgcaaagtatcttttctctttaaagttt
gatgtatttgtcccatgtttgcccggtcattgtgctaaaccttctgcactcgatcgcgtg
gtatggcaggattggtcttattttgcgcaagataagtacaaaatgatatcaaaaaagtac
aatgaagtgtttataagcggaatatgtcttggagcgctactttgtcttgaaattagtaga
agatttccagttagggcacaggccttgctctctcctacccttgctatagatggatggaat
atcccatggtacaaatttttgcttccccttgctttcattcctccctttatttggctttat
tcttacaaagaatctgagccatacggaataaaaaatgaatctgttaggcgccaggtctta
aggattatgcaaaataaatcatcaggcgtatatgagagttacagcgcaattgcaattaga
gaacttttaagattttcaaaaagtgtaaagctttatctaaaagagattaaaaccccaact
cttgttattcactccactcaagacgatctttgtaatataaagaacgctaaagacttgtat
aataagttgtcatcgaaagacaaaaagtttgtcgaattgcacgattcatatcacatggta
acacttgacaacgaaagggatatggtgtttaaagagtgtagtgatttttttataaaatat
tcagaggcggtggatgagcaagactattaa

DBGET integrated database retrieval system