KEGG   Thermodesulfobium narugense: Thena_0232Help
Entry
Thena_0232        CDS       T01488                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_0232
   01230 Biosynthesis of amino acids
    Thena_0232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0232
   00030 Pentose phosphate pathway
    Thena_0232
   00051 Fructose and mannose metabolism
    Thena_0232
   00052 Galactose metabolism
    Thena_0232
  Energy metabolism
   00680 Methane metabolism
    Thena_0232
Enzymes [BR:tnr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thena_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244619..245548
Genome map
AA seq 309 aa AA seqDB search
MIYTITLNPALDRQIWVEDIKYDESNRIIRETTYAGGKGIDVSRVLANFGADNVALGFVG
GFSGEELEGRLLNDGVRCNFTYISTNTRTNIILNDEKTKSQTLFNAMGPEVQPQDLMRLI
KQIQNLPNPEYVIISGSLPVGVQPAFYNKLIDTAKEIGATVVFDTDGKAMKVGLSSKPHI
IKPNIHELERLVDKKLKDIPEIAQEARSICKKGINIVLVSMGANGMLCVSSTEEYWAFPP
PVNVQNTIGAGDSSVAGFVLALKEGKSLKEALAFAVAAGTATTTRPGTAVCLPEDVEAIY
PNVTFRDVV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatatatacaataactttaaatccagctcttgacagacagatatgggttgaggacata
aagtatgacgaatcaaataggattattcgagaaactacttatgcaggtggaaaaggcata
gacgtttccagagttcttgccaacttcggagctgataacgttgctttaggtttcgttggt
ggcttttctggagaagagcttgaaggcagactgctcaacgatggtgtaaggtgcaacttt
acctacatttccactaacacgaggacaaatataattctaaatgacgaaaagacaaaatcc
caaactctttttaatgcaatgggccctgaagtgcaaccacaagatttaatgaggcttata
aaacagattcaaaatttgcctaaccctgaatacgttataattagtggcagtttacctgtt
ggcgttcaacctgctttttataataaacttatagatacagccaaagaaattggtgctaca
gtggtctttgatactgatggcaaagctatgaaagttggtctttccagcaaacctcatata
ataaaaccaaatattcacgaattagaaagattggttgataaaaaacttaaagatatacct
gaaatagctcaggaggcaaggtccatttgcaaaaagggaattaatatagtgttagtttct
atgggcgcaaatgggatgctttgcgttagttctacagaagagtattgggcatttcctcca
cctgttaatgtacaaaacaccattggtgcaggcgattcatcagttgctggttttgtatta
gctttgaaggaaggcaaaagtttaaaagaggcacttgcttttgctgttgcggccgggacg
gctactactacgagaccaggaacagcagtttgcttgcctgaagatgtagaggctatttat
ccgaatgtaactttcagagacgttgtctaa

DBGET integrated database retrieval system