KEGG   Thermodesulfobium narugense: Thena_0248Help
Entry
Thena_0248        CDS       T01488                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
tnr  Thermodesulfobium narugense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thena_0248
DNA repair and recombination proteins [BR:tnr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thena_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263052..263663
Genome map
AA seq 203 aa AA seqDB search
MKYPKPLSDLSHELSLLPGIGPKLALRLAFFISQRGEEKNLSLIEALQNLKNIKKCSQCN
ALSETDPCEICSDPSRNNEILCVVSDVRDLWKIESTKSYSGRYFVLNSLIVPLEGIDPEK
AGMTELFSLIRAKKPKEIVIAFDFSMEGQTTSLYIKERLSSQRDQLGYIPQLTRLAVGLS
MGDNLGNTDEFTISQAILHRQKI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagtaccccaagcccttgagcgatttgtctcatgaattatcccttcttccggggatt
gggccaaagttggctttgaggttagctttctttatttctcagagaggcgaagaaaaaaat
ctttctcttattgaagcgctgcaaaatttaaaaaatataaaaaaatgttctcagtgtaac
gctttgtctgagactgatccatgtgaaatatgctcggatccatctagaaataacgaaatc
ttatgtgttgtttcggacgtgagagatctgtggaagatagaatcaactaaatcttattct
ggcaggtattttgttttaaacagcctgattgtaccgctggaaggtattgacccagagaaa
gctggtatgacagaactcttcagtttgattcgtgcaaaaaaacctaaagaaattgttata
gcgttcgacttcagtatggaaggacaaactacttccttatatataaaagaaaggctctca
agccaaagagatcagttaggttatataccacaattaacccgtcttgcggtagggctttct
atgggtgataaccttggcaacacagacgagtttaccatttcacaagcaatattgcataga
caaaaaatatag

DBGET integrated database retrieval system