KEGG   Thermodesulfobium narugense: Thena_0395Help
Entry
Thena_0395        CDS       T01488                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00521  Streptomycin biosynthesis
tnr00523  Polyketide sugar unit biosynthesis
tnr01130  Biosynthesis of antibiotics
Module
tnr_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Thena_0395
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thena_0395
Enzymes [BR:tnr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Thena_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEE14039
UniProt: M1E7L0
Position
403640..404206
Genome map
AA seq 188 aa AA seqDB search
MPFEFIKTDIPEVMIVKPKVFGDERGFFLETYKREDFVKAGIYKEFVQDNHSKSVKGVLR
GLHYQLNPKAQGKLVRCIKGKIFDVAVDIRKNSPTFLKYVSVELSEENKFMLWVPEGFAH
GFLTLSDEAEIMYKVSGSTYSPEHDRSLRWNDPEIGINWPLEGEPILSKKDKDAPLLKNA
DINFVYEI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgccatttgaatttataaagactgatattccagaagtgatgatagtaaagcctaaggta
tttggcgatgagagaggatttttcttagaaacttataaaagagaagactttgtaaaagct
ggaatatataaagaatttgtccaggataaccattctaagtcagtaaagggagttttaaga
ggtcttcactatcagctaaatcccaaggctcaaggaaagctggtaaggtgtataaagggt
aagatatttgacgtagcagtggatattagaaaaaacagcccaacgtttctaaaatatgta
tcagtagagctttcagaagaaaataaatttatgctttgggtgcctgagggatttgcacat
ggattcttaaccctatcagatgaagcagagatcatgtacaaggtatctggcagcacatac
tcaccagaacatgacagatcgttaagatggaatgatcctgagattggtataaattggcca
ttggagggtgagccaattctttcaaagaaggacaaagatgcaccacttctaaagaatgca
gatattaattttgtgtatgaaatttag

DBGET integrated database retrieval system