KEGG   Thermodesulfobium narugense: Thena_0472Help
Entry
Thena_0472        CDS       T01488                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_0472
   01230 Biosynthesis of amino acids
    Thena_0472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0472
   00030 Pentose phosphate pathway
    Thena_0472
   00051 Fructose and mannose metabolism
    Thena_0472
  Energy metabolism
   00680 Methane metabolism
    Thena_0472
Enzymes [BR:tnr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thena_0472
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thena_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475914..476762
Genome map
AA seq 282 aa AA seqDB search
MKIRLDILKFDVSGYVDNISVHPVVVEKLECFFSNLVSENEVLDYNVLALANKVLIIVVT
DAERFKEANDIDKILYSVIENIEKADFNFTLEKSSIKQFKNFFFTERKNEGILIFFSTNV
EVVSHNIAILKLLFDPFTNVNIFKADISKLYTINLQFNERLKSYIQFKDLFKLVKDMKKS
NLKFFVQSIESQNSEPVMASLEDGSVSLWRVSEPFFHINLILRALVENTLPVTFYDSSNA
LAFPKSLAVGFTLQNGKLFGPVDLFDDSFYESLRSKFYEKNY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaggttagacatccttaagtttgacgtgtcaggttatgttgataacataagc
gtgcatcctgtagtggttgagaagttggagtgctttttctcaaatttagttagtgaaaat
gaagttcttgactacaacgtattggctcttgcgaacaaagttttaataatagtggttacg
gatgccgaaaggttcaaagaagccaatgacattgataagattttgtacagtgtaatagaa
aatatagaaaaggctgattttaattttacgcttgaaaaatctagcattaaacaatttaaa
aatttctttttcacagaaagaaaaaatgagggtatattaatattcttttcaactaatgtt
gaagttgtatctcacaatatagcaatattgaagctattgttcgatccttttacaaatgtg
aatatctttaaagctgatatttctaaactatataccatcaatttgcaatttaatgagcgc
ttgaaatcttatattcaatttaaagatctttttaaattagtaaaggatatgaagaaatcg
aatttaaaattttttgttcaatcaattgagagtcaaaattctgagcccgtgatggcatct
cttgaagatggaagcgtttccttgtggagggtgtctgagccattttttcatataaacctt
attttaagagctttagttgaaaatactttgcctgtgactttctatgattcatctaacgct
ttagcttttcccaagtcattggctgtgggtttcactctccaaaatggaaaactttttggc
cctgttgatctatttgatgactctttttacgaatctttaagaagtaaattctatgaaaaa
aattattga

DBGET integrated database retrieval system