KEGG   Thermodesulfobium narugense: Thena_0472Help
Entry
Thena_0472        CDS       T01488                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_0472
   01230 Biosynthesis of amino acids
    Thena_0472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0472
   00030 Pentose phosphate pathway
    Thena_0472
   00051 Fructose and mannose metabolism
    Thena_0472
  Energy metabolism
   00680 Methane metabolism
    Thena_0472
Enzymes [BR:tnr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thena_0472
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thena_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475914..476762
Genome map
AA seq 282 aa AA seqDB search
MKIRLDILKFDVSGYVDNISVHPVVVEKLECFFSNLVSENEVLDYNVLALANKVLIIVVT
DAERFKEANDIDKILYSVIENIEKADFNFTLEKSSIKQFKNFFFTERKNEGILIFFSTNV
EVVSHNIAILKLLFDPFTNVNIFKADISKLYTINLQFNERLKSYIQFKDLFKLVKDMKKS
NLKFFVQSIESQNSEPVMASLEDGSVSLWRVSEPFFHINLILRALVENTLPVTFYDSSNA
LAFPKSLAVGFTLQNGKLFGPVDLFDDSFYESLRSKFYEKNY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaggttagacatccttaagtttgacgtgtcaggttatgttgataacataagc
gtgcatcctgtagtggttgagaagttggagtgctttttctcaaatttagttagtgaaaat
gaagttcttgactacaacgtattggctcttgcgaacaaagttttaataatagtggttacg
gatgccgaaaggttcaaagaagccaatgacattgataagattttgtacagtgtaatagaa
aatatagaaaaggctgattttaattttacgcttgaaaaatctagcattaaacaatttaaa
aatttctttttcacagaaagaaaaaatgagggtatattaatattcttttcaactaatgtt
gaagttgtatctcacaatatagcaatattgaagctattgttcgatccttttacaaatgtg
aatatctttaaagctgatatttctaaactatataccatcaatttgcaatttaatgagcgc
ttgaaatcttatattcaatttaaagatctttttaaattagtaaaggatatgaagaaatcg
aatttaaaattttttgttcaatcaattgagagtcaaaattctgagcccgtgatggcatct
cttgaagatggaagcgtttccttgtggagggtgtctgagccattttttcatataaacctt
attttaagagctttagttgaaaatactttgcctgtgactttctatgattcatctaacgct
ttagcttttcccaagtcattggctgtgggtttcactctccaaaatggaaaactttttggc
cctgttgatctatttgatgactctttttacgaatctttaagaagtaaattctatgaaaaa
aattattga

DBGET integrated database retrieval system