KEGG   Thermodesulfobium narugense: Thena_0492Help
Entry
Thena_0492        CDS       T01488                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00020  Citrate cycle (TCA cycle)
tnr00620  Pyruvate metabolism
tnr00633  Nitrotoluene degradation
tnr00640  Propanoate metabolism
tnr00650  Butanoate metabolism
tnr00680  Methane metabolism
tnr01100  Metabolic pathways
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
Module
tnr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0492
   00020 Citrate cycle (TCA cycle)
    Thena_0492
   00620 Pyruvate metabolism
    Thena_0492
   00640 Propanoate metabolism
    Thena_0492
   00650 Butanoate metabolism
    Thena_0492
  Energy metabolism
   00680 Methane metabolism
    Thena_0492
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thena_0492
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thena_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AEE14132
UniProt: M1E4G4
Position
493698..494273
Genome map
AA seq 191 aa AA seqDB search
MKSYWEIRWHARGGQGAWTASQFLASAALSVNKYFQSFPEFGAEREGAPIVAYTKISDMP
IKNYSQIEEPDAVVVLDPTLFSQVNFLNGLKSDGYLIVNYPGDPKQLREELKIPPGIKVF
TVDATKIALETLKRPITNTTMAGALVKATGILNFEDVVNEMIRSFSGKFKQEIIDANVNA
IRRAYEEVKQG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttattgggaaattcgttggcatgcaagaggaggacagggggcatggacagcc
tctcaatttctggcatcagctgcactaagcgttaataaatattttcaatcctttcctgaa
tttggagccgaaagagaaggagctcccattgtagcgtatactaaaatttctgatatgcca
ataaaaaattattcccaaatagaggaaccagatgctgtggtagttctcgatcctacttta
ttttcccaggtaaactttttaaacggtcttaagagtgacggatatttaatagtcaattat
cctggtgatcctaagcagcttagggaagagttaaaaattcctcccgggataaaagttttt
acggttgatgcaacaaagatagctttggaaacattaaagaggcctataaccaataccact
atggcaggtgcactggttaaggcgacaggaatactcaattttgaagatgttgtgaatgaa
atgataagaagctttagcggtaagttcaagcaagaaattattgatgccaacgttaatgct
attagaagagcatatgaggaggtgaagcagggatga

DBGET integrated database retrieval system