KEGG   Thermodesulfobium narugense: Thena_0493Help
Entry
Thena_0493        CDS       T01488                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0493
   00020 Citrate cycle (TCA cycle)
    Thena_0493
   00620 Pyruvate metabolism
    Thena_0493
   00640 Propanoate metabolism
    Thena_0493
   00650 Butanoate metabolism
    Thena_0493
  Energy metabolism
   00680 Methane metabolism
    Thena_0493
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thena_0493
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thena_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
494270..494629
Genome map
AA seq 119 aa AA seqDB search
MNKDIKRIEVPCEEKLVWEEMPLGNTLVGGANSECLKTGTWRVQHPTVNKEKCTNCMTCW
LFCPDMSIVVEKKNNKYEMLGFDPVHCKGCGVCSKVCPVNAIEMVLGSDFENTEKPFLR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagatataaagagaattgaagtgccatgtgaagagaagttagtttgggaagag
atgccccttggaaatactttagtagggggtgctaactctgagtgtttgaaaacaggcacc
tggagagttcaacatcctacagtaaataaggagaaatgtacaaattgcatgacttgttgg
ctcttttgtccagatatgtcaattgttgtcgaaaaaaagaacaataaatatgagatgctt
ggatttgatcctgtgcactgtaagggttgtggagtttgtagtaaggtttgtcctgtaaat
gctattgaaatggtattaggatctgattttgaaaatactgaaaagccatttttgagataa

DBGET integrated database retrieval system