KEGG   Thermodesulfobium narugense: Thena_0494Help
Entry
Thena_0494        CDS       T01488                                 

Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_0494
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0494
   00020 Citrate cycle (TCA cycle)
    Thena_0494
   00620 Pyruvate metabolism
    Thena_0494
   00640 Propanoate metabolism
    Thena_0494
   00650 Butanoate metabolism
    Thena_0494
  Energy metabolism
   00680 Methane metabolism
    Thena_0494
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thena_0494
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thena_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494641..495828
Genome map
AA seq 395 aa AA seqDB search
MARKSVGLTGDYAVAEAMRQIDPDVVAVYPITPQTLIVEKFGEFVADGIVHTEFVPVESE
HSALSACCGASAAGARTMTCTSSQGLALMHEILYIAAGNRHPIVMVDVNRALSAPINIHG
DHSDTMGSRDAGWIHLYCFNGQEAYDSTIIATRIAENPNVYLPVIVGLDAFNISHNTERI
ELLDDQEVKDFVGEFNPPYSLLDLKYPVSVGAYFLPDYYMEARRKLQEVIQNSKKVIVEI
HEEYNKKFGRNVPAIMETYKMEDAEYAILAMSSITGVAMLAADELRSKGIKAGVIRLRLF
RPFPADELYEAISNLKGLAVVERADAYGAACAPIFSELSGACANKKKMPLMANYVIGLGG
RDVKIKDMKSIFEDIVAKVNKGEVKDLRQYIGVKG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaaaagtgttggtttaactggagattatgcagtagcagaagcaatgagacaa
attgatccagatgtagttgcagtctatcctattacgcctcagactttgatagttgaaaag
tttggagaatttgtggctgacggtattgttcatactgaatttgttcctgtagaatcagaa
cattcagcactttcagcatgttgtggagcgtcggctgctggagctagaacaatgacttgt
acatcttcacagggtcttgctcttatgcatgaaattttatatatagcagcaggaaataga
catccaatcgtaatggtagatgtcaatagagcactttctgctcctattaacattcacggc
gatcacagcgatactatgggttcaagagatgctggctggattcatctttattgtttcaac
ggccaagaggcatacgattcaactattatagcaacaagaattgctgaaaatccaaatgtt
tacctgccagttattgtaggtcttgatgcttttaacatttctcataacactgaaaggata
gaacttttagatgatcaagaggtaaaagactttgttggagagtttaatccaccttattcg
cttttggatttgaaatatccagtaagtgtgggtgcttactttttgccagattactatatg
gaggcaagaagaaaacttcaggaggttatccaaaattcaaaaaaggtaattgtagaaatt
catgaagagtataacaagaagtttggaagaaatgttcctgctattatggaaacttataag
atggaagatgccgagtatgctatattggctatgtcatcaataacgggcgttgcaatgctt
gcagctgatgaactgagatctaaggggattaaagcaggtgttataagacttagactcttt
agaccatttcccgctgatgaattatatgaggctatttctaatttgaaaggtttagctgtt
gtagaaagggcagatgcctatggagcagcatgtgcacctattttttcagaattgtctggt
gcttgtgcaaataaaaagaagatgcctctaatggccaactatgtaattggtttgggcgga
agagacgtaaaaatcaaagatatgaaaagtatttttgaggatatagtggctaaagttaat
aaaggagaggtaaaagatttgagacagtatataggcgtgaaaggataa

DBGET integrated database retrieval system