KEGG   Thermodesulfobium narugense: Thena_0600Help
Entry
Thena_0600        CDS       T01488                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tnr  Thermodesulfobium narugense
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tnr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tnr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580489..581706
Genome map
AA seq 405 aa AA seqDB search
MKTSGSKNGSLPIMAAALLFDSPVFLSNVPYLLDVNTMAKIISSLGGRVDFKGNSEVLID
PSNVSRYDPPLEPVIAMRASFLVAGALLARFGRAKVALPGGCAIGSRPVDIHLKGFEALG
VKRSIEHGFVNLECDKLKGANIYLSYPSVGATENLIMASVFAEGMTVIDNAAKEPEILGL
SEFLNLCGAKIRGAGSRTIEIEGVKSLKPIDNYSIIPDRIEAGTLMLAGAITQGDILVEN
INPDYLSSVIEKMIEAGIEVLPEKNSIRVRCKNRPKPVTIKTSPHPGFPTDMQAQFMALL
SLGEGTSVITEMVFENRYLHAEELSRLGADIRIDGRTAVIVGVNHLSGAPVRALDLRAGA
ALVIAGLIAEGETRVFGLSHLNRGYENLEVKLSNLGASISKEVLP
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactagcggttcaaaaaatgggtcgctgcctataatggcagcggctctactattt
gattcacctgtgtttttgtctaacgttccatatttattggacgttaacactatggcaaaa
ataatttcaagtcttgggggtagagtcgattttaagggaaactcagaggttttaattgat
ccttcaaacgtatcaaggtacgatcctcctttagaacctgttatagctatgagagcatct
tttttggtagcgggggcacttcttgcaagatttggtagagcaaaagtagctcttcctgga
ggttgtgctattggttctagaccagtagatatacaccttaagggttttgaggctctaggt
gtaaaaagatcaattgaacatggttttgtaaatcttgaatgcgataaacttaaaggtgca
aatatttatttgtcttacccaagcgtgggtgctactgagaatttgattatggcatctgtg
tttgcagagggcatgacagttatcgataatgcagcaaaggaaccagagatattaggtctt
tcagaatttttaaatttatgcggagcaaaaattaggggagctggttcaagaactattgaa
attgaaggagtaaaatctcttaaaccaatcgataattattcgattatacccgatcgtatt
gaagctggtactttaatgcttgcaggagcgataacacagggtgatattcttgtagagaat
ataaatcctgactatttgagttctgttattgaaaagatgatagaagcaggtattgaagtt
ttgccagagaaaaatagcatcagggtaagatgtaaaaatagacctaaaccagtaactata
aaaacatctccacatccagggtttcctacagatatgcaggcacaatttatggccctatta
tcgttgggcgagggtacttctgttataacagaaatggtttttgaaaatagatatttgcat
gctgaggaattgagcagattgggtgcagatattagaattgacggaagaactgcagttata
gtgggggttaatcacttatcgggtgcaccagtaagagctctcgatttaagagctggtgct
gcgcttgtaattgccgggctaattgcagaaggagaaacaagggtttttggactttcacat
cttaatcgtggctatgaaaatttggaagtcaaactcagtaatcttggtgcatcaatatct
aaagaagttttaccttaa

DBGET integrated database retrieval system