KEGG   Thermodesulfobium narugense: Thena_0726Help
Entry
Thena_0726        CDS       T01488                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tnr  Thermodesulfobium narugense
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tnr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tnr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704105..705049
Genome map
AA seq 314 aa AA seqDB search
MISHLLSTRYLDLDEVLEIFDNAKKFLEVLNRPTKKIPILKGKLILTVFFEPSTRTRTSF
EIAGKTLGADVINLSVSQSSAKKGETIKDTCLTLNAMKPDCIVLRHSVSKIPEYITNFTS
AKVINAGDGSNEHPSQALLDAFTLMQHFKDLKDKKILILGDVLNSRVARSNIWLLKKFGA
KISLCGPSTLVREEFEKEWDVDVYWDLDKAITNADAIIVLRIQLERAASAWIPSTREYSI
FYGLNREKLMKNSNVIIMHPGPMNRGLEISSDVADGRNALIRNQVTNGVAIRMSIFYHLL
AHKTGNIGDHLKLN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctcacttgcttagtactagatatcttgatttagacgaagtcttagaaatattt
gataatgcaaaaaaatttttggaggtattaaatagacccacaaaaaagataccaattctt
aaaggtaagctcattctaacagtattttttgaacctagcacacgaacgagaacttctttt
gaaattgcaggtaaaactttgggcgcagatgttattaacctatccgtttctcaaagctct
gccaaaaaaggagaaactattaaggatacttgtttaacacttaatgctatgaagccagac
tgtattgtattaagacattctgtttcgaaaattcctgagtatataacaaattttacatca
gcaaaggtaattaatgcaggcgacggttcgaacgagcatccttctcaagctttgcttgat
gcttttacattgatgcaacattttaaagatctgaaagataaaaaaattttgatcttagga
gatgttttaaacagcagggtagcaagatcaaatatctggcttttaaaaaaatttggagct
aaaatttctctttgtgggccatctactcttgtgagagaagaatttgagaaagaatgggat
gtagatgtttactgggatttagataaagctattactaatgcagatgcaattatagtgcta
aggattcagctagaaagggctgcaagcgcctggattccaagtactagagagtattctatt
ttttatgggttaaatcgtgagaaattgatgaaaaacagtaatgttataattatgcaccca
ggacctatgaacaggggtcttgagatatcatctgacgtagctgatgggagaaatgcgctt
ataagaaatcaagtaacaaatggagtagcaataagaatgtctattttttatcatttgtta
gctcataaaactggtaatataggagatcatttgaaattaaattaa

DBGET integrated database retrieval system