KEGG   Thermodesulfobium narugense: Thena_0865Help
Entry
Thena_0865        CDS       T01488                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00350  Tyrosine metabolism
tnr00625  Chloroalkane and chloroalkene degradation
tnr00626  Naphthalene degradation
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0865
  Lipid metabolism
   00071 Fatty acid degradation
    Thena_0865
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thena_0865
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thena_0865
   00626 Naphthalene degradation
    Thena_0865
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thena_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 IGFBP
Motif
Other DBs
NCBI-ProteinID: AEE14495
UniProt: M1E7J4
Position
863339..864352
Genome map
AA seq 337 aa AA seqDB search
MKALVLDKISKVEDRPLKIMEVEVQSPGESEILVEISCCGICHTELDEIEGRVIPKLPII
LGHQIVGRVKEIGKKVTKFRLGDRVGIAWINSACGKCYFCKRGEENLCNDFKATGCDVDG
GYAQYCLISENFCYKIPDNFSDVQAAPLLCAGAVGYRSLKLTNMNDYECIGLFGFGASAH
IVIQIIRKLYPNSKVFVFTRRKDDTASKMAQDMGADWVGATGDKPPKRLNRAIDTTPAGY
VIREALSILEKGGRLVTNLIRKESLIPELNYQEHLWNEKELKSVANITRDDVKEFLDIAS
SIPIVSKVNEFDFEDANKALVMLKHGEYKGAGVLIVK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttagtgttagataaaatttcaaaagttgaagatagacctcttaaaattatg
gaggtagaagtacaaagtccaggtgaaagcgagatattggtagaaatatcttgctgtgga
atatgccatactgaattagatgagatagaggggagagtaataccaaaactacctataatt
ctaggtcatcagatagttggtagagttaaagaaattgggaaaaaagttacaaagtttaga
ctaggtgatagagttggcattgcgtggataaattcagcatgcggaaaatgttacttttgt
aaaaggggcgaagaaaacctttgcaatgattttaaggctacaggctgtgatgtagatggt
ggttatgctcagtactgcttgatatctgaaaatttttgttataaaattccagataacttt
tctgacgttcaggccgcgccgcttctatgtgctggagcagtaggatatagatcgcttaag
ctaactaatatgaatgactacgagtgcattggtctttttggttttggtgcatcggctcat
atagtaattcaaataataagaaagctttatccaaattcaaaagtatttgtgtttactagg
cgaaaagatgatacagcaagcaaaatggcacaagatatgggtgctgattgggtaggagct
acaggagacaagccccctaaaagattgaatcgcgctattgatactacacctgctggttat
gtaataagagaagctctaagcattcttgaaaaaggcggtaggttggtgactaatcttatc
agaaaagaatctctaataccagaacttaactatcaagaacatctgtggaatgagaaagag
ctaaaaagtgtggccaatattacaagagatgacgtaaaagaatttttggatatagcatct
tctattccaatagtgtcaaaagtgaacgaatttgattttgaagacgcaaacaaagcgtta
gtaatgttaaaacatggagaatataaaggagcgggtgttttaattgttaaatag

DBGET integrated database retrieval system