KEGG   Thermodesulfobium narugense: Thena_0865Help
Entry
Thena_0865        CDS       T01488                                 

Definition
(RefSeq) zinc-binding alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thena_0865
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0865
  Lipid metabolism
   00071 Fatty acid degradation
    Thena_0865
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thena_0865
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thena_0865
   00626 Naphthalene degradation
    Thena_0865
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thena_0865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863339..864352
Genome map
AA seq 337 aa AA seqDB search
MKALVLDKISKVEDRPLKIMEVEVQSPGESEILVEISCCGICHTELDEIEGRVIPKLPII
LGHQIVGRVKEIGKKVTKFRLGDRVGIAWINSACGKCYFCKRGEENLCNDFKATGCDVDG
GYAQYCLISENFCYKIPDNFSDVQAAPLLCAGAVGYRSLKLTNMNDYECIGLFGFGASAH
IVIQIIRKLYPNSKVFVFTRRKDDTASKMAQDMGADWVGATGDKPPKRLNRAIDTTPAGY
VIREALSILEKGGRLVTNLIRKESLIPELNYQEHLWNEKELKSVANITRDDVKEFLDIAS
SIPIVSKVNEFDFEDANKALVMLKHGEYKGAGVLIVK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttagtgttagataaaatttcaaaagttgaagatagacctcttaaaattatg
gaggtagaagtacaaagtccaggtgaaagcgagatattggtagaaatatcttgctgtgga
atatgccatactgaattagatgagatagaggggagagtaataccaaaactacctataatt
ctaggtcatcagatagttggtagagttaaagaaattgggaaaaaagttacaaagtttaga
ctaggtgatagagttggcattgcgtggataaattcagcatgcggaaaatgttacttttgt
aaaaggggcgaagaaaacctttgcaatgattttaaggctacaggctgtgatgtagatggt
ggttatgctcagtactgcttgatatctgaaaatttttgttataaaattccagataacttt
tctgacgttcaggccgcgccgcttctatgtgctggagcagtaggatatagatcgcttaag
ctaactaatatgaatgactacgagtgcattggtctttttggttttggtgcatcggctcat
atagtaattcaaataataagaaagctttatccaaattcaaaagtatttgtgtttactagg
cgaaaagatgatacagcaagcaaaatggcacaagatatgggtgctgattgggtaggagct
acaggagacaagccccctaaaagattgaatcgcgctattgatactacacctgctggttat
gtaataagagaagctctaagcattcttgaaaaaggcggtaggttggtgactaatcttatc
agaaaagaatctctaataccagaacttaactatcaagaacatctgtggaatgagaaagag
ctaaaaagtgtggccaatattacaagagatgacgtaaaagaatttttggatatagcatct
tctattccaatagtgtcaaaagtgaacgaatttgattttgaagacgcaaacaaagcgtta
gtaatgttaaaacatggagaatataaaggagcgggtgttttaattgttaaatag

DBGET integrated database retrieval system