KEGG   Thermodesulfobium narugense: Thena_0907Help
Entry
Thena_0907        CDS       T01488                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thena_0907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thena_0907
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thena_0907
Enzymes [BR:tnr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thena_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904859..906355
Genome map
AA seq 498 aa AA seqDB search
MFYKSTRGSDKKLLASETILEGLSEDGGLFVPEQIPTINIKEVSKLERYQDVAFLILKNF
LTDYTDDEISYCIERAYNFDKFDSKFVAPIFILNKNCSITELWHGPTQAFKDIALQIMPL
LLSIAKDKNNVKNEIVILVATSGDTGKAALEGYRDVKGTKIIVFFPHNGVSEIQRLQMVT
QEGTNTFSFAVKGNFDDVQNSVKSIFNDIILNKKLLQNGFELSSANSINWGRLVPQIVYY
FYSYIQGLKNNLFDINSEINFVVPTGNFGNILAGYYAKKMGLPVKKLICASNSNNVLTDF
INTGIYNRKRKFYKTISPSMDILISSNLERLLYDLSDSDAGYISKLMNQLKEKGEYKINN
DLHSKIKDLFWADWADDVETKEQIYKDFKENNYLLDTHTAVGRTVYLKYISQTKDFTPTF
ILSTANPYKFSISIYEALFGKPEYDKSEFDLMFEIEEKTKVLIPAPLRSLKEKDIIHKSI
INKEHMVDEILKILGIKS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttttataaaagcactagaggaagtgataaaaaactcttagcttctgagactattcta
gaaggcttatcagaagatggaggactttttgttcctgaacaaataccaacgattaatata
aaagaagtttcgaaattggaaaggtatcaagatgttgcttttttaatactaaaaaatttt
ttaacggattatactgacgatgagataagctattgtatagaaagagcctataattttgat
aaatttgatagtaaatttgttgctcctatttttattcttaataaaaactgttcaataact
gaattatggcatggtccaacacaagcgtttaaggatattgctcttcaaattatgccgctt
ttattatctattgcgaaggataaaaataatgtaaaaaatgaaattgttattttggtggca
acatctggtgatacaggcaaggcagctcttgaagggtatagggatgtaaagggtactaaa
attattgtttttttccctcacaacggagtgagtgaaattcaaagattgcaaatggttact
caggaaggaacaaacacattttctttcgcagtgaaaggaaattttgatgatgttcaaaac
agcgtaaaatcaatttttaacgacataattttaaacaaaaagctcttgcaaaacggtttt
gaactttcttctgcaaattcgataaattgggggagactagttccccaaatagtgtattat
ttttattcttatatccaaggtttgaaaaataatttgtttgatataaattcagaaataaat
tttgttgttcctactggcaactttggtaatatattggctggctactatgcgaagaagatg
ggtctaccggttaaaaaacttatttgtgcttcaaacagcaacaacgtccttacagacttt
ataaatacaggaatatacaatagaaaaaggaaattttataaaactatttcgccttcaatg
gacattttgatttctagcaatttagaaagattattatatgatttgtctgattcagatgca
ggctatatttcaaagctaatgaaccaactaaaagaaaaaggtgaatacaagataaataat
gatttacactccaagataaaagatctgttttgggctgattgggctgatgacgtggagaca
aaggagcaaatttataaagattttaaagaaaataattatcttttagatacgcatactgca
gtaggaagaacagtttacctaaaatatatcagtcaaacgaaagactttacaccgacattt
atattgtctaccgcaaacccttataaattttctataagtatctacgaagccctatttggt
aagccagaatatgataaaagtgaatttgatttaatgtttgaaatagaagaaaaaacaaag
gttctaattccagcaccactaaggtctctaaaagagaaagacataattcataaaagtata
ataaataaagaacatatggtagatgaaatactgaaaatcttaggtataaagtcataa

DBGET integrated database retrieval system