KEGG   Thermodesulfobium narugense: Thena_1055Help
Entry
Thena_1055        CDS       T01488                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tnr  Thermodesulfobium narugense
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_1055
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thena_1055
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Thena_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064463..1066220
Genome map
AA seq 585 aa AA seqDB search
MFEDKFSRVLYIDLSKKSFTIKSRPDLFEKWLGGTGVGIQILKEECPKNVDPFSPDNTVI
FAVGPITSLYPLASKTIAIFKSPLTGNLGESHAGGRSAVSIMMAGYGAIVIKGKSDIPVY
LSIFDNEVRFHDARAIWGIKDAITVGKIIRQKETFSGQRSIMRIGRAGENLVSFASLNTE
TYRHFGRLGLGAVFGSKNLKAIVIAGKRTINLSDPKAYLRIYKNILDETTSSLMKKYHDL
GTAANVLPLHEIGGLPIENLNRTSYEGAIELSGENLAQNYLGRRIACTGCPVACVHIAAF
RDPHEEEKYFYKTSMIGYDYEPIYSLGTMLGIKDAKGFLKLMDRTEKLGLDAMSSGVALA
WATEMLNKNLITEKETLVKFSFGNWERYIEGLENIVSMPNDFYKALAKGTSYASKIYGGK
DFALNFGKNEMPGYHTGPAAHLGWFLGARHSHLDNAGYSMDQSLKGNYPRPEKLIDNLIE
EEANRQILSSLVVCFFARAIYLNFDNTINCLKTIGIDLTKEELKELGMEIYRQKMSYKTQ
EGWLPNFQDLPKRIFETSAPFGKISEEYMNKAIDYFRKRLEKDFR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagacaaatttagtcgcgttctttatatagacctttcaaaaaaaagctttacc
ataaaatctagacctgatttattcgagaagtggcttggaggaactggtgtaggaattcaa
atactaaaggaagagtgcccaaaaaatgtagatccatttagtcctgataataccgtaata
tttgcagttggacctattacttctctttatcctcttgcatccaaaactattgctattttc
aaatcacctttaactggcaacttaggagaaagtcatgcaggcggcagaagtgcagtaagt
attatgatggcaggctatggtgcaatagttattaagggaaaatcagacataccagtttac
ctttcaatatttgacaatgaagtcaggtttcatgatgcaagggctatttggggaataaag
gatgcaataactgttggaaagataatcaggcaaaaagagacattttcaggtcaaaggagc
ataatgagaataggaagagctggagaaaatcttgtaagctttgcatcgctaaatactgaa
acttatagacacttcggaaggttaggcttgggagccgtttttggaagtaagaacttaaaa
gccattgtgatagctggcaaaagaacgataaacttatctgatccaaaagcatacctaaga
atctataaaaatattttagatgaaaccacatcaagtcttatgaagaaatatcatgacctt
ggaacagcagcaaacgtccttcctcttcacgaaattggaggacttcctattgaaaactta
aacagaacttcttatgaaggtgcaatagagctctcaggagaaaatcttgctcaaaattat
cttggaagaagaatagcatgtacaggttgtccggtcgcatgtgttcatatagcagcattt
agagatccgcatgaagaagaaaaatatttttataaaacatctatgatcggttatgattat
gagcccatttattcacttggaaccatgcttggcattaaagatgctaagggtttcttaaag
ttaatggatagaaccgaaaaattaggtcttgatgcaatgtcatcaggagtagcactcgcc
tgggctactgagatgttaaacaaaaatcttatcactgagaaagaaactttagtcaaattt
tcatttggaaactgggaaagatatattgaaggtttagaaaacattgtttcaatgccaaat
gatttttacaaagcacttgcaaaaggcacaagttatgcatcaaaaatttacggtggtaaa
gattttgcacttaattttggaaaaaatgaaatgccaggttatcataccggaccagccgct
cacctcggatggtttttaggagcaaggcatagccacttagacaatgcaggctatagcatg
gatcagagcttaaaaggcaactacccaaggccagaaaaattaatagataatctaatagaa
gaagaagcaaatagacagattctgtcaagtcttgtagtttgtttctttgcaagagctata
tatcttaactttgacaatacaataaattgcctaaaaacaataggcatagatctaactaaa
gaagaacttaaagaattaggcatggaaatttatagacaaaagatgtcatataaaactcag
gaaggatggctaccaaattttcaagatctgccaaagagaatttttgaaacctccgctccg
ttcggaaaaatctccgaagaatacatgaacaaagcaatagattattttagaaagagatta
gaaaaagattttcgttga

DBGET integrated database retrieval system