KEGG   Thermodesulfobium narugense: Thena_1088Help
Entry
Thena_1088        CDS       T01488                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00020  Citrate cycle (TCA cycle)
tnr00640  Propanoate metabolism
tnr00660  C5-Branched dibasic acid metabolism
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thena_1088
   00640 Propanoate metabolism
    Thena_1088
   00660 C5-Branched dibasic acid metabolism
    Thena_1088
Enzymes [BR:tnr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Thena_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 GARS_A Lambda_CIII
Motif
Other DBs
NCBI-ProteinID: AEE14714
UniProt: M1E8X3
Position
complement(1106632..1107729)
Genome map
AA seq 365 aa AA seqDB search
MRLFEYQAKSILSEYLNVPKGVIIDKENVDQVVTKLNFPCVLKAQVKVGGRGKAGGVLKV
KDSNELKNALEKLFSMEIKGEKVNRILAEELIDIDRELYFSVIFYRPSRRYMMVFCKEGG
VDIEQLAEAKPDAINKVKVDPIIGIKDFMIRNLIKDFELYNILNQFVKSAYKIFVEKDLV
MLEINPLVITKNKEVICADAKVEFDDNALYKHPEFEAFLEQSEIEARKLGFSFVPLEGDI
GILGNGAGLVLATIDSVTRAGGKCANFLDIGGGAKAERVKSALKFLVEQKKLKGILINVF
GGITRADEVAKGLLEFEEEQKLNLPVVVRLSGTKAEEGLEMLKERFEIVSSLRDGAKKIV
ELVNQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagactttttgaatatcaggccaaaagtattttaagtgaatatttaaacgtaccaaag
ggagttattatcgacaaggagaatgtggaccaagttgttacaaaattaaatttcccatgc
gttctgaaggcacaagtaaaggttggaggcaggggaaaagctgggggggttctaaaggta
aaggattccaatgaattaaaaaacgctcttgaaaaacttttttctatggaaatcaaaggc
gaaaaggttaacaggattcttgcagaagaactaatagacattgatagggaactttatttt
agcgttattttttacagaccttcgagaagatatatgatggttttttgtaaagagggcggc
gttgatatagagcagcttgctgaagcaaaacctgatgcaattaataaagtgaaagttgac
ccaattattggtataaaggattttatgataagaaacttgataaaagattttgaactttat
aacatattgaatcaatttgtaaaaagtgcatacaaaatttttgttgaaaaagaccttgta
atgcttgaaataaaccctcttgttattacaaagaacaaggaagtaatatgtgctgatgca
aaagttgagttcgatgataatgctctttataaacatcctgaatttgaggcctttctcgaa
caatctgaaatagaagcaagaaaattaggcttttcatttgtaccattggaaggtgatatt
ggaattttaggaaacggtgcggggttagttttggctactattgattctgtaactagagca
ggtggaaagtgtgctaactttttagatattggaggcggagcgaaagccgaaagggttaag
agcgcgctaaaatttctagtagaacaaaagaagcttaaaggtatcctaataaacgtattt
ggtgggattacaagagctgatgaggttgcaaagggtttgttagaattcgaagaagagcag
aaattaaatcttccagtagtagtaagactttctggaaccaaagctgaagaaggattagaa
atgcttaaggaaagattcgaaatagtttcatctttaagagatggcgctaaaaagatagta
gagttagttaatcaataa

DBGET integrated database retrieval system