KEGG   Thermodesulfobium narugense: Thena_1191Help
Entry
Thena_1191        CDS       T01488                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tnr  Thermodesulfobium narugense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thena_1191
   00052 Galactose metabolism
    Thena_1191
   00500 Starch and sucrose metabolism
    Thena_1191
   00520 Amino sugar and nucleotide sugar metabolism
    Thena_1191
Enzymes [BR:tnr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thena_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1225935..1226807)
Genome map
AA seq 290 aa AA seqDB search
MIRKAVFPVAGMGTRFLPATKASPKEMLPLVDRPLIQYVVEEVLESGIKYMIFVTGRNKR
PIEDYFDASWELEYILKDKDKSSLLADVDKIRDDAEFIYVRQPRPLGLGHAVLMSSAVID
NEPFAVVLGDDIINSEIPAMKQLIKVYERYHSPVLALERVPEEEVSSYGIALAKPIPDDD
GVLKITDLIEKPEIHESPSNYAVIGRYILVPEIFDILRETKPGRGGEIQLTDALRTLCER
RLVLGVEVKGKRYDCGSKIGYLKATVDFALQHPEFKDEMKNHLLEICKDL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaaaggcagtttttcctgtcgcagggatgggaacaaggtttttgccagctacc
aaagcgtctcccaaggaaatgttaccattagtagacagacccctaattcagtatgtcgtg
gaagaagttctggaatcaggaataaaatatatgatatttgttacgggtaggaacaaaaga
cctattgaagactattttgatgcttcatgggaactagaatatatattgaaagataaagat
aaatctagtttattagctgatgtagacaaaattcgtgatgatgccgagtttatctatgtt
agacagccaaggccattaggactagggcacgcagtacttatgtcttctgcagtaatagat
aacgaaccctttgctgtagttcttggcgatgacattataaattctgaaattcctgctatg
aaacagctaattaaagtttatgagagatatcatagtccagtcttagcccttgagagagta
ccagaagaggaggtcagcagttatgggatagctcttgcaaagccaattccagatgatgat
ggagtgctaaaaattaccgatcttattgagaagcctgagatccatgagtctccttcaaac
tatgctgtgattggtagatatatacttgtgcctgagatttttgatattttgcgagaaaca
aaaccaggtaggggcggcgagattcagctaactgatgcacttaggactctttgtgaaagg
agattggttttaggagtagaggttaaaggtaaaagatatgactgtggctcaaagattgga
tatttaaaagccacagtcgattttgcacttcaacatccagagtttaaagatgagatgaaa
aatcatttgttagaaatttgtaaagatttataa

DBGET integrated database retrieval system