KEGG   Thermodesulfobium narugense: Thena_1629Help
Entry
Thena_1629        CDS       T01488                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thena_1629
   01230 Biosynthesis of amino acids
    Thena_1629
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_1629
   00051 Fructose and mannose metabolism
    Thena_1629
   00562 Inositol phosphate metabolism
    Thena_1629
Enzymes [BR:tnr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thena_1629
Exosome [BR:tnr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thena_1629
  Exosomal proteins of bladder cancer cells
   Thena_1629
  Exosomal proteins of melanoma cells
   Thena_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677822..1678520
Genome map
AA seq 232 aa AA seqDB search
MNYAIANFKMNKTSDEVDEYICELRQNLKNSVKTVICPSFVSLERAVKASFGSLIEIGAQ
NLFFEEKGAFTGEISIGMLESVGVKYAIIGHSERRHYFKESDDLLFKKVKAAANRLKVIY
CFGETEEERDAGKSLEVTLNQLNLVKSFFENIILAYEPVWAIGTGKTANAEGSFALIKEL
ESKLGALPDCLYGGSVNHKNAKSFIDAGFKGVLVGSASLDVKEFSKIIENMS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgctatcgcaaactttaaaatgaataaaacttcagatgaagtagatgaatat
atttgtgaattaagacaaaatctaaaaaacagcgttaaaactgtaatttgtccttccttt
gtctctcttgaaagagccgtgaaagcctcctttggatccttaatagagatcggcgctcaa
aatctatttttcgaagaaaaaggcgccttcacaggagagatatccattggaatgttagaa
agtgtaggagtaaaatacgcgataattggtcactctgaaagaagacactacttcaaagaa
tcagatgatttgttgtttaaaaaggttaaagctgcagctaatagattaaaagtaatttat
tgctttggcgaaacagaagaagaaagagacgctggcaaatcacttgaagtaacgcttaat
cagttaaatttagtaaaaagctttttcgaaaatataattctcgcatatgaaccagtctgg
gcaataggaactggtaaaactgctaacgcagaaggatcatttgctttaattaaagaatta
gaatcaaaattaggagccctcccggattgtctttatggtggttcagtcaatcataaaaac
gcaaaatcatttattgatgcaggatttaaaggcgtattggttggttcggcaagccttgat
gtaaaagaattttcaaaaattatagaaaacatgtcttaa

DBGET integrated database retrieval system