KEGG   Thermodesulfobium narugense: Thena_1703Help
Entry
Thena_1703        CDS       T01488                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tnr  Thermodesulfobium narugense
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tnr01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tnr00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1748624..1750357
Genome map
AA seq 577 aa AA seqDB search
MKWIRVNMSDLSVKVEDVPKKYEQMGGRWLTSSIIADEVPATCHPLGPLNKVVIAPGILS
GTTAPSSGRISVGTKSPLTGGIKEANAGAKFGQYLKRMGYSAIIVEGQPKNKESRYLLNI
SKEKVELIGADEYKFMGLYELNEKLAAKYGKDVGIACVGPAAEHLLAGTGVAFNDVENRP
ARYAGRGGVGAAFASKGLKAIVVEAVTGQATILNNELFETGRKKLLAALQEHAVTKPKGA
LNTYGTAVLVNILNEAGALPTRNFSSGTFEGAKKISGEAMAEAAAKNPQAGMMGHRCHPG
CVIGCSVVYPDAQGKSHTSVEYETLWAIGANCGIDDLDAIAQMNTMCNDIGLDTIEFGDA
VAVAMEGGLLPFGDAKGAIALLEEVRKGNPLGKIIGSGCSTVGKVFGVRRVPAVKNQGMP
AYEPRVIKGIGVTYITTPMGADHTAGYSIAPEILGVGGKFDPHTNEGKVKLSKDFQATTC
FIDSTGCCVFTAFAILDIPSGFEGMVEACNAVTGANWTTSDAYEIGLNILKTEHQFNLAA
GFTANDDRPPEFMKLEPVPPHNMVWDMADSELDSIWK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggattcgcgttaacatgtcagacctttctgtaaaggtcgaggatgtaccaaag
aaatacgaacaaatgggaggcagatggctaacatcctccataatagcggatgaagtgcca
gctacgtgccaccctctaggtcctttgaacaaggtggtaattgcgcctggtatcctgagt
ggtaccacagctccgtcctcaggaagaatttctgttggcacaaaatctcctttaacaggt
ggcataaaagaagcaaatgcaggagcaaaatttggccagtatctcaaaagaatgggttac
agcgctattatcgtcgaaggacaaccgaagaataaagaatctaggtatttattgaacatc
agcaaggaaaaagtagagctaattggtgcagatgagtacaagtttatggggctttacgaa
cttaacgaaaaattagcagcaaaatatggcaaagatgtgggaatagcatgtgtaggccca
gcagcagaacaccttttagctggaactggtgtggccttcaacgatgttgaaaacagaccg
gccagatatgcgggaagaggcggagtaggagccgcatttgcatcaaagggcttgaaggca
attgtagtagaagccgtaactggacaggctacaatcttaaataacgaactatttgaaacc
ggtaggaaaaaacttcttgcagctcttcaagagcacgcagtaaccaaaccaaagggcgca
ctaaatacttatggtaccgctgtactagtaaacatattaaacgaggcaggagcacttcct
actagaaatttctctagtggaacgtttgaaggcgcaaaaaagatatctggcgaagctatg
gcagaagcagcagccaaaaatccacaagctggcatgatgggtcacaggtgccatcctggc
tgtgtaataggttgcagtgtggtatatccagacgcacaaggaaagtctcatacttcagtt
gaatatgaaactttatgggcaattggtgcaaactgcggaatagatgaccttgatgccata
gcacagatgaacactatgtgtaacgacattgggcttgacacaatagaattcggtgatgct
gttgcagtagcaatggaagggggtctgcttccctttggagacgcaaaaggagcaatagct
ttacttgaagaagtaaggaaaggaaacccacttggaaagatcataggttctggatgcagc
acagtaggaaaggtcttcggcgtcagaagagtgcccgctgtaaaaaatcagggcatgcca
gcttatgaaccaagagttatcaagggtataggcgtaacatatatcaccacaccaatgggt
gcagatcatacagcaggatattcaattgccccagaaatactcggggttggtggaaagttt
gaccctcatacaaacgaaggcaaggtgaaattgtcaaaagacttccaggcaaccacttgc
tttattgactcgactggttgctgcgtgtttacagcctttgccatacttgatatcccaagc
ggctttgagggaatggtagaagcatgcaacgcagtcactggagccaactggactactagc
gatgcctatgaaataggtttaaatatcttaaaaaccgagcatcagtttaacctagctgca
ggttttactgccaacgacgataggccacctgaatttatgaaacttgagcctgttcctcca
cacaatatggtttgggatatggctgattctgaattagattctatctggaagtaa

DBGET integrated database retrieval system