KEGG   Thermodesulfobium narugense: Thena_1769Help
Entry
Thena_1769        CDS       T01488                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tnr  Thermodesulfobium narugense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thena_1769
Enzymes [BR:tnr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Thena_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821053..1821619
Genome map
AA seq 188 aa AA seqDB search
MDQEKIKRAIYDILVAIGEDPNREGLKDTPERIARMYEEIFSGINEDPLSVLNVEYHENT
DEMVLIKDIPFYSICEHHLIPFIGRAHVAYLPKDGRVVGLSKIARVVDILSKKPQLQERL
TSEIARTIMKGLNPLGVAVVVEAEHLCMSMRGIKKPGHTTVTSALRGAFKASSSTRSEVL
SLIFGRLI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggatcaagaaaaaataaaaagagcaatttacgatatattggtagcaattggggaagac
ccaaatagagaaggccttaaggacacacctgagaggatagcaaggatgtatgaagaaata
ttttcaggcataaacgaagaccccctctcagtgctcaacgtagaatatcacgaaaatacc
gacgaaatggtacttataaaagatataccgttttattccatctgtgagcaccatctcatt
ccttttatagggagagcacacgttgcctatcttccaaaagatggcagggttgttggactc
tctaagatcgcaagggttgtagacatactatcaaaaaaacctcaacttcaagaaagatta
acatcagaaattgccagaacaataatgaaagggctaaaccctttgggagtggcagttgta
gtagaagccgagcatctttgcatgagcatgagagggataaaaaaaccggggcacactact
gttacctctgctttaaggggagccttcaaggcttcttcttctacaagatctgaagttctt
agtttgatcttcggaaggcttatatga

DBGET integrated database retrieval system