KEGG   Thermodesulfobium narugense: Thena_1770Help
Entry
Thena_1770        CDS       T01488                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00790  Folate biosynthesis
tnr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thena_1770
Enzymes [BR:tnr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Thena_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEE15376
UniProt: M1E7R7
Position
1821616..1822455
Genome map
AA seq 279 aa AA seqDB search
MIFKARNRSFDLKKTIIFGILNVTPDSFYDGGRWCEPDIAIKRAFKMIEEGADIIDLGGE
STKPFVDPTPLDVEIERILPVLKELVKNDISVSVDTYKPEVAKIALEEGAIIINDIFGLR
SEGMLETISSFNPKPGIIIMHMKKNPKEMQINPEYDNIFNEISEFLHAQAKKAISAGFTK
ENILLDVGLGFGKSFKDNLKLCSNYERFLKDNFLHLIGPSRKSFTGLVSKGVPTEDRLPA
TISVSSICVYKGIHALRVHDVKEIRLACDMAEEMRKLNI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatatttaaagcacgtaacagaagttttgatttgaaaaaaactattatctttggaatt
ttaaacgtaacgcccgattcattttatgacggcggcaggtggtgtgaacccgatatagca
ataaagagagccttcaaaatgattgaagaaggcgcagatataattgacttaggcggggaa
tctacaaaaccttttgttgatcctaccccgctagatgtagaaatagaaagaattctgcca
gttttaaaggaattggtcaaaaatgatataagcgtttcagttgacacctacaagccagag
gtggcaaaaattgctctggaagaaggcgctatcataattaacgatatctttggccttaga
tctgagggcatgttagaaacaatttcttcatttaatcctaagcctggcataattataatg
cacatgaaaaagaatcctaaagaaatgcagattaatcctgagtatgacaacatctttaac
gaaatctcagaatttctgcacgctcaagctaaaaaggccatcagtgctggttttacaaaa
gaaaatatactcttagatgttggacttggctttgggaagagttttaaggataatttgaaa
ctgtgctcaaattatgaaaggtttttaaaagacaatttccttcacctcataggcccttct
agaaaaagttttactggacttgtttcaaagggcgttcctactgaggatagattgccagca
actattagcgtatccagcatatgtgtttacaagggaatacatgcacttcgagtccacgat
gtaaaagaaataagacttgcttgtgatatggcagaagaaatgagaaaattaaatatttaa

DBGET integrated database retrieval system