KEGG   Thermodesulfobium narugense: Thena_1771Help
Entry
Thena_1771        CDS       T01488                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tnr  Thermodesulfobium narugense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tnr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1822455..1822961
Genome map
AA seq 168 aa AA seqDB search
MPFAYLSLGSNIGYRKKYLKKAIKFLRKNCCELLAVSNIYTTEPLEVTNQPYFANCLIKV
KTKLSPISLLHLCKHIEKEIGRFKTFRYGPRVIDIDILSYNYCIGSNDMIEILNHSYNVA
NKELTIPHPKSVERDFIRVLFDEVLGNSYKKLQGVNRGDKIGHRASRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgcatatttgtctcttggatcaaacattggatataggaaaaaatatttaaaa
aaagcaataaagtttttaagaaaaaactgctgtgaattgctagctgtttcgaatatatac
actacagaacctcttgaggttaccaatcaaccatattttgcaaactgtttgataaaagtc
aaaacaaagctttcacccatctctctccttcatttgtgcaaacacatagaaaaggaaata
gggaggtttaaaacatttagatatgggccaagagttattgacattgatatattaagttat
aattattgtataggaagtaatgatatgatagaaatattaaaccattcttataatgtagca
aataaagaattgaccatcccacacccaaaaagtgtggaaagggatttcattagagtctta
tttgatgaagttctcggaaattcttataagaaattacaaggagtgaacagaggggataaa
attggccacagagctagtagaagttaa

DBGET integrated database retrieval system