KEGG   Thermodesulfobium narugense: Thena_1841Help
Entry
Thena_1841        CDS       T01488                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01130  Biosynthesis of antibiotics
tnr01230  Biosynthesis of amino acids
Module
tnr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thena_1841
Enzymes [BR:tnr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thena_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth IMPDH NanE
Motif
Other DBs
NCBI-ProteinID: AEE15447
UniProt: M1E660
Position
1888367..1889161
Genome map
AA seq 264 aa AA seqDB search
MNILEEISKRETEEFNQRREFLNVFKKYGRIYPIVSFSDALKPISIIGEFKPASPVKGIF
IKNPKKEIRNFIDIYEKIGCKAISVLTNKRDFNGDPLYISYIKAFCNLPILYKNFILLED
QIEEAFLLGADCVLLIASILKPKRLKSLYAFANNLGLDSLIEIHDEEELNVVLELKPKII
GINNRNLKTFEVDINNTFRLSKNIPGEIKIVSESGIKSSEEIDKLFNCGISGVLIGEAMV
KLANKPGDLKLKNFLKNSNVQNAC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcttggaagaaatttcaaaaagagagacagaagagtttaatcaaagaagagaa
tttttaaatgtgtttaaaaaatacggaagaatataccctattgtttccttttctgacgcc
ttaaaaccaataagcattataggagaattcaagccggcctcacccgtaaagggaatcttt
attaaaaatcctaaaaaagaaattagaaattttattgatatctacgaaaagattggctgc
aaagccatttcagttttaacaaacaaaagggattttaatggagatccattatacatctct
tacataaaagcattttgcaacctgcctatcctatacaaaaatttcattcttttagaagat
caaatagaagaggcttttttgctaggtgctgattgtgtactacttatagcttctattcta
aaaccaaaaagattaaagtctttatatgcttttgctaacaatcttggccttgattcctta
atagaaattcacgacgaagaagagttaaatgtggttttagaattaaaaccaaaaataatt
ggaattaataacagaaacctaaaaacttttgaagtcgatatcaacaatacttttaggcta
tcaaaaaatatacccggtgaaatcaaaatagtttcagaatcaggaataaagtcctcagaa
gaaattgataaactttttaactgcggtatttcaggagttcttataggagaagcaatggta
aaactagccaataaacccggtgatctaaagcttaaaaattttttaaaaaatagtaacgtt
caaaatgcttgttaa

DBGET integrated database retrieval system