KEGG   Thermodesulfobium narugense: Thena_1843Help
Entry
Thena_1843        CDS       T01488                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thena_1843
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thena_1843
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thena_1843
Enzymes [BR:tnr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thena_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1889767..1890960
Genome map
AA seq 397 aa AA seqDB search
MNKTLNGNFGKFGGAFVPETLIYALDELENYYNKIRGDRDFFREFNNLLTEYAGRPTPLT
YAPNFSKRFEINTYLKREDLLHTGAHKLNNCLGQGLIAKGLNKKRIIAETGAGQHGVATA
TVCAFLKIPCEIYMGSIDYERQKLNVFRMQLLGARVNKVESGSKTLKDAMNEALRDWVTN
INTTHYMIGSAAGPHPFPTIVRDFQRVIGEEARSQIFKSTGTLPDAIFACVGGGSNSIGL
FKAFIQDESVKIFGAEAAGKGIETGLHSATLSAGRPGVLHGSLSYLLQNSDGQVEEAHSI
APGLDYPGVGPEHSYLKESKRAIYEGITDDEALEALEILAKEEGIICALESAHAVALAIK
KVKELGKGSTIIISLSGRGDKDMQTIMNSLEAKNEQN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaaccttaaatggaaattttggcaaatttggaggtgcttttgttcctgaaact
cttatatacgcgctagatgaactagaaaattattacaacaaaataagaggagatagagat
ttctttagagaatttaacaacttattaacagaatatgcaggaaggcctaccccactaaca
tatgcccctaatttttccaaaagatttgaaataaatacatatctaaaaagagaagattta
cttcacacgggcgctcataaactcaataattgtcttgggcagggcttgattgctaagggg
ttaaacaaaaaaagaattattgcagaaactggagcaggtcaacacggtgtggccacagct
acagtttgtgcatttttgaagataccctgtgaaatatatatgggctctattgactatgaa
agacagaagttaaacgtattcagaatgcaacttcttggcgcaagggtaaacaaagttgag
agcggatcaaaaactctaaaggatgcaatgaacgaggccttaagagattgggtaacaaac
atcaacaccacacactatatgattggatcagccgctggtcctcatccttttccgacaata
gtaagagattttcaaagagtaatcggtgaagaggcaagatctcaaattttcaaaagtaca
ggaactctcccagacgcaatctttgcctgtgtaggtggaggcagcaattctataggtcta
ttcaaagcttttatccaagatgaaagcgttaaaatttttggcgcagaagctgcgggcaaa
gggatagaaacaggtctacattcagccaccctctcagcaggtagaccaggagtgttacac
ggttctcttagttatctcttacagaattctgacggacaagtagaagaagctcattctatt
gctcctggactagattacccgggagttggtccagagcactcatatctgaaagaatcaaaa
agagctatatatgaaggaataaccgatgatgaagctctggaagctcttgaaattcttgca
aaagaagagggaataatttgtgctcttgagagcgcacacgctgtagctttagccataaag
aaggtaaaggaattaggaaagggtagcacaattattataagtctatcgggcagaggagat
aaagatatgcaaacaattatgaatagtctggaggcaaaaaatgagcaaaattaa

DBGET integrated database retrieval system