KEGG   Thermodesulfobium narugense: Thena_1844Help
Entry
Thena_1844        CDS       T01488                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00260  Glycine, serine and threonine metabolism
tnr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01130  Biosynthesis of antibiotics
tnr01230  Biosynthesis of amino acids
Module
tnr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thena_1844
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thena_1844
Enzymes [BR:tnr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thena_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth LemA
Motif
Other DBs
NCBI-ProteinID: AEE15450
UniProt: M1E994
Position
1890947..1891705
Genome map
AA seq 252 aa AA seqDB search
MSKIKEILKEKKTLIPFLPAGYPSLNATKQFVKVLVECGIKAIEIGIPFSDPVADGPTIT
NSYSYAIKNRIKSEDVYLLSEELKDEYKISIIPMLYYNLIYNKGEENFAKRISTFADAVI
VPDLPFRESHRLRPHLEKFNISYIPFATPNIREEDIRIISKYTNAFIYAVTVFGITGARS
NYSKDTYKYLERVKKISSNFVAAGFGVSSKEQFERLPTDAVIIGSALVKQIDPNNLEKSK
ENIKKLINSIIN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattaaagaaattttaaaagaaaagaaaactttgattccttttttgcctgct
ggttatccatcactaaatgccactaaacagtttgttaaagtgttagtagagtgtgggata
aaagcaattgaaattggaattcctttttcagatccagttgcggacggccctactattaca
aacagttattcttatgctattaaaaatagaataaagagcgaagacgtttatctattgtca
gaagagttaaaagatgaatacaaaatttcaattattccaatgctttattacaatcttata
tataataagggtgaagaaaatttcgcaaaaaggatttctacctttgcagatgcagtaata
gtgccagatttaccctttagagaatctcataggctaaggccccatcttgaaaaatttaat
atctcttatattccttttgcaacaccaaatataagagaagaggatataagaattatctca
aagtatacaaatgcatttatatatgcagttacagtttttggcattacaggtgcaagatcc
aattacagtaaagatacatataagtatttagagcgagtaaaaaaaattagttcaaacttt
gtagccgctggatttggcgtcagttcaaaagagcaatttgaaaggctgccaactgatgca
gtaattataggaagtgccttagttaagcaaattgatcctaacaaccttgaaaaaagcaaa
gaaaatattaaaaagctaataaatagcataattaattaa

DBGET integrated database retrieval system