KEGG   Thermodesulfobium narugense: Thena_1844Help
Entry
Thena_1844        CDS       T01488                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tnr  Thermodesulfobium narugense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thena_1844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thena_1844
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thena_1844
Enzymes [BR:tnr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thena_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1890947..1891705
Genome map
AA seq 252 aa AA seqDB search
MSKIKEILKEKKTLIPFLPAGYPSLNATKQFVKVLVECGIKAIEIGIPFSDPVADGPTIT
NSYSYAIKNRIKSEDVYLLSEELKDEYKISIIPMLYYNLIYNKGEENFAKRISTFADAVI
VPDLPFRESHRLRPHLEKFNISYIPFATPNIREEDIRIISKYTNAFIYAVTVFGITGARS
NYSKDTYKYLERVKKISSNFVAAGFGVSSKEQFERLPTDAVIIGSALVKQIDPNNLEKSK
ENIKKLINSIIN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattaaagaaattttaaaagaaaagaaaactttgattccttttttgcctgct
ggttatccatcactaaatgccactaaacagtttgttaaagtgttagtagagtgtgggata
aaagcaattgaaattggaattcctttttcagatccagttgcggacggccctactattaca
aacagttattcttatgctattaaaaatagaataaagagcgaagacgtttatctattgtca
gaagagttaaaagatgaatacaaaatttcaattattccaatgctttattacaatcttata
tataataagggtgaagaaaatttcgcaaaaaggatttctacctttgcagatgcagtaata
gtgccagatttaccctttagagaatctcataggctaaggccccatcttgaaaaatttaat
atctcttatattccttttgcaacaccaaatataagagaagaggatataagaattatctca
aagtatacaaatgcatttatatatgcagttacagtttttggcattacaggtgcaagatcc
aattacagtaaagatacatataagtatttagagcgagtaaaaaaaattagttcaaacttt
gtagccgctggatttggcgtcagttcaaaagagcaatttgaaaggctgccaactgatgca
gtaattataggaagtgccttagttaagcaaattgatcctaacaaccttgaaaaaagcaaa
gaaaatattaaaaagctaataaatagcataattaattaa

DBGET integrated database retrieval system