KEGG   Thermococcus nautili: BD01_0386Help
Entry
BD01_0386         CDS       T03065                                 

Definition
4-aminobutyrate aminotransferase-related aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
tnu  Thermococcus nautili
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BD01_0386
   00650 Butanoate metabolism
    BD01_0386
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BD01_0386
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BD01_0386
Enzymes [BR:tnu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BD01_0386
Amino acid related enzymes [BR:tnu01007]
 Aminotransferase (transaminase)
  Class III
   BD01_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
331176..332510
Genome map
AA seq 444 aa AA seqDB search
MLPKDEVIQGYSRYISRASHVTYAPIVPYKARNALVWDVEGREYIDFLSDAAVQNVGHNN
PRVVEAVKKTAERLLHFTFIYGFPAEPYLLARKLSELAPVENAKVAFGLSGSDANDGAIK
FARAYTGRRSVIGYLRSYYGSTYGAMSVTGLDFEVRSKVGQLSDVHFIPYPNCYRCPFGK
EPGKCRMECLEYLKEKFEGEVHAEGVALLLAEPIQGDAGMVVPPEGYFRKLKRLLDEHGI
LLGVDEVQSGLGRTGRWFAIEHFGVEPDIITLAKPLGGGLPISAIVGRGEIMDSLPPLGH
AFTLSGNPVASAAALAVIEEIEEKNLLQRAEKLGKKAKERLERMKKRHELIGDVRGLGLM
LGVDLVKDRETKERAYDEAKKVVWRAYELGLIVAFLQGNVLRIQPPLTIEEELLEEGLDK
LEEAIEDVEEGRVSDEVLEKVQGW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
ttgctcccaaaggatgaggttattcagggctactcccgctacatctcgcgcgcatcccac
gttacctacgccccaatcgtcccctacaaagctcgaaacgccctcgtctgggacgttgaa
gggagggagtacatagacttcctgagcgatgcggccgttcagaacgtcgggcacaacaac
ccgagggttgtcgaggcagtcaaaaagacagctgagaggttgcttcacttcacctttatc
tacggctttccggctgagccgtaccttctcgcccggaagctgagcgaacttgcaccggtt
gagaacgcgaaggttgccttcggcctcagcgggagcgacgctaatgacggggccataaaa
ttcgcgagggcctacactggaaggaggtcggtaatcggctacctcaggagctattacggc
tccacctacggggccatgagcgttaccggtctcgattttgaggttcgctcgaaggtcggc
cagctcagcgacgttcacttcatcccctaccccaactgctaccgctgtcccttcgggaaa
gaaccggggaagtgccgtatggagtgccttgagtacctcaaggagaagttcgagggcgag
gttcacgctgagggagtagctcttctcttagctgagccgatacagggcgatgccggaatg
gtggttccgcccgagggctacttcagaaagctcaaaaggctcctcgacgaacacggcatt
ctcctcggcgttgatgaagtccagagcggtctcgggaggacgggcaggtggttcgccatc
gagcacttcggcgttgagcccgacatcataaccctcgcaaagccccttggcggtggattg
cctataagtgcaatcgtcggaaggggggagataatggattccctgccccctctcggccat
gcattcaccctctcaggaaaccccgtcgcgagcgccgcggctttagccgtcatcgaggaa
atcgaggagaagaacctccttcagagggccgaaaagctcgggaagaaagcaaaagaaagg
cttgaaagaatgaagaagaggcacgagctcatcggcgacgtccgcgggcttggcctgatg
ctcggcgttgacctcgttaaggacagggaaaccaaggagagggcctacgacgaggccaag
aaggtcgtctggagggcctacgagctggggttaatagtggcctttctccagggcaacgtg
ctgaggattcagcccccgctgacgatagaggaggagctccttgaggaaggccttgacaag
cttgaagaagcaattgaggacgttgaagaaggcagggtttcagatgaagtccttgaaaag
gtgcaggggtggtga

DBGET integrated database retrieval system