KEGG   Thermosediminibacter oceani: Toce_0214Help
Entry
Toce_0214         CDS       T01289                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
toc  Thermosediminibacter oceani
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Toce_0214
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0214
  Lipid metabolism
   00071 Fatty acid degradation
    Toce_0214
  Amino acid metabolism
   00350 Tyrosine metabolism
    Toce_0214
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Toce_0214
   00626 Naphthalene degradation
    Toce_0214
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Toce_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
210888..212039
Genome map
AA seq 383 aa AA seqDB search
MDFQFFVPTRILFGRGRVREAGNYGKGLGKKALVVTGKSSARKSGSLDKLTKSLEENGVE
WVLFDGVEPNPLTTTIDRGAVFARENKVDLVIGLGGGSAMDTAKGIAFAAANDGPIVDYM
EGRTGEKALPLILIPTTSGTGSEANNIAVMTNPVTMVKKGFRNPSIFAVVSIVDPDLTAT
MPRKVTASTGIDAFFHAVESILSLRCQPFTEILSLKAIELIYNNIMKACADGKDSDSREA
MALASTMAGMALGQSGVCLLHGMEHPLSSYYGASHGEGLAPLAGAFLRFVKPFASERLAK
VAKAMGLDVEGLSADEAAQKAVEAVEQMLKELGLPDSISQFGVKEEDIEKLAQHVYKYMG
HNLETTPGSPGYEDIKRMYLESL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttggattttcaattttttgttccgacccgaatattgttcggcagggggagggtgcgtgaa
gcaggcaattacggaaaaggtcttggcaagaaagccctggtggttaccggaaagtccagt
gccaggaaatcgggcagcctggataaactcacgaaaagccttgaggaaaacggcgtggag
tgggtgctgttcgacggtgttgaacccaaccccttgaccactactattgacaggggcgct
gtttttgccagggaaaacaaagtggacctggtgataggcctcggcggcggcagcgctatg
gataccgccaagggcatagccttcgcagccgccaatgatgggccgatagtcgattacatg
gaaggcaggaccggagaaaaggcactgccgctgatcctcataccgaccacctcaggcacc
ggcagcgaggccaacaacatagccgttatgacaaacccggtgacgatggtcaagaaaggc
ttcagaaatccgtcgattttcgctgtagtctccattgtggacccagacctgacggccaca
atgccccgaaaagtgacggcttcgacgggtatcgacgcctttttccacgctgtggaatcg
attctgagcctcaggtgccagccctttacggaaattctgtccctgaaggcgatagagctc
atatacaataatataatgaaagcgtgtgcggacgggaaagattcggacagccgcgaggct
atggctctagccagtaccatggctggtatggctttagggcaatccggtgtgtgcttgctt
cacgggatggaacaccccctgagcagctactacggggcatcccacggcgagggactggcg
ccgctggccggggcgtttttgagattcgtgaaaccctttgcatcggaaaggttggcgaag
gtggcaaaggccatgggacttgacgtcgagggactttcggccgacgaagccgcacagaaa
gctgtagaggctgtggagcaaatgctgaaagaactcggcctgccggacagcatttcccag
ttcggagttaaagaagaagacatagaaaaactggcacagcacgtatataaatacatggga
cacaaccttgaaactactccgggtagtccgggatacgaagatataaagcggatgtatcta
gagtcgctgtag

DBGET integrated database retrieval system