KEGG   Thermosediminibacter oceani: Toce_0214Help
Entry
Toce_0214         CDS       T01289                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
toc  Thermosediminibacter oceani
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Toce_0214
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0214
  Lipid metabolism
   00071 Fatty acid degradation
    Toce_0214
  Amino acid metabolism
   00350 Tyrosine metabolism
    Toce_0214
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Toce_0214
   00626 Naphthalene degradation
    Toce_0214
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Toce_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
210888..212039
Genome map
AA seq 383 aa AA seqDB search
MDFQFFVPTRILFGRGRVREAGNYGKGLGKKALVVTGKSSARKSGSLDKLTKSLEENGVE
WVLFDGVEPNPLTTTIDRGAVFARENKVDLVIGLGGGSAMDTAKGIAFAAANDGPIVDYM
EGRTGEKALPLILIPTTSGTGSEANNIAVMTNPVTMVKKGFRNPSIFAVVSIVDPDLTAT
MPRKVTASTGIDAFFHAVESILSLRCQPFTEILSLKAIELIYNNIMKACADGKDSDSREA
MALASTMAGMALGQSGVCLLHGMEHPLSSYYGASHGEGLAPLAGAFLRFVKPFASERLAK
VAKAMGLDVEGLSADEAAQKAVEAVEQMLKELGLPDSISQFGVKEEDIEKLAQHVYKYMG
HNLETTPGSPGYEDIKRMYLESL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttggattttcaattttttgttccgacccgaatattgttcggcagggggagggtgcgtgaa
gcaggcaattacggaaaaggtcttggcaagaaagccctggtggttaccggaaagtccagt
gccaggaaatcgggcagcctggataaactcacgaaaagccttgaggaaaacggcgtggag
tgggtgctgttcgacggtgttgaacccaaccccttgaccactactattgacaggggcgct
gtttttgccagggaaaacaaagtggacctggtgataggcctcggcggcggcagcgctatg
gataccgccaagggcatagccttcgcagccgccaatgatgggccgatagtcgattacatg
gaaggcaggaccggagaaaaggcactgccgctgatcctcataccgaccacctcaggcacc
ggcagcgaggccaacaacatagccgttatgacaaacccggtgacgatggtcaagaaaggc
ttcagaaatccgtcgattttcgctgtagtctccattgtggacccagacctgacggccaca
atgccccgaaaagtgacggcttcgacgggtatcgacgcctttttccacgctgtggaatcg
attctgagcctcaggtgccagccctttacggaaattctgtccctgaaggcgatagagctc
atatacaataatataatgaaagcgtgtgcggacgggaaagattcggacagccgcgaggct
atggctctagccagtaccatggctggtatggctttagggcaatccggtgtgtgcttgctt
cacgggatggaacaccccctgagcagctactacggggcatcccacggcgagggactggcg
ccgctggccggggcgtttttgagattcgtgaaaccctttgcatcggaaaggttggcgaag
gtggcaaaggccatgggacttgacgtcgagggactttcggccgacgaagccgcacagaaa
gctgtagaggctgtggagcaaatgctgaaagaactcggcctgccggacagcatttcccag
ttcggagttaaagaagaagacatagaaaaactggcacagcacgtatataaatacatggga
cacaaccttgaaactactccgggtagtccgggatacgaagatataaagcggatgtatcta
gagtcgctgtag

DBGET integrated database retrieval system