KEGG   Thermosediminibacter oceani: Toce_0321Help
Entry
Toce_0321         CDS       T01289                                 

Definition
uroporphyrinogen-III C-methyltransferase ;uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
toc  Thermosediminibacter oceani
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Toce_0321
Enzymes [BR:toc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Toce_0321
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Toce_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
315493..317058
Genome map
AA seq 521 aa AA seqDB search
MIAVTGKVYLIGAGPGDPGLLTLKAVRVLKKADAVLYDRLMNREILTLARKDAELIDVGK
APDNHPVPQHRINEILLEKALKGMTVVRLKGGDPFVFGRGSEEALYLTERGVPVEVVPGV
TSAIAVPAYAGVPVTHRGISSSFHVITGSDGCGERADWDSLSRLKGTLIFLMGVKNLESI
VSNLLKYGKPADTPAAMIMWGATPAQKTVTGTLADIVRRVKEAGIKNPAVFVVGGTVGLW
EYLNWFEGKPLHGRRILVTGTIDAEKGQPEDGPFDFLEDAGAEVIHCPTVKIEFDYGETA
GFLANAGDLNLLVFTSKNAVTAFAGAMRRMRLDLRRLGGATVAAVGRKTAERLEEVFIYP
DLVPEEFTSKDLLEKIPAGGGGKRTAAVITSDIGGQELVGGLEARGYRVMKIAAYKNLPN
YDVRERLIEELGKGVDAAVFTSPSSFYRMEQMVGKLPEKLKKVFIAAIGPTTAAAIEKTG
LKVDVCPKEHTLEGLQKALLEKFVGRGEGDGGNKKAQEIEI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgatagcagtgaccggtaaggtttatctcataggcgccggccccggagaccccgggctt
ttgaccctcaaagccgtccgggtgctgaagaaggccgatgcggtgctgtacgaccggctc
atgaatagggagatcctgactctggcaagaaaagatgctgaactcatcgatgtgggaaag
gctccggataaccaccccgtgccccagcacaggattaatgaaatactgctggaaaaagct
ttaaagggcatgaccgtagtcaggttaaagggcggagaccctttcgttttcggcaggggg
agcgaggaagccctttacctgacggagagaggagtgccggtggaagtggtgccgggggtt
acttcagccatcgcggtgccggcttacgccggggtaccggtaacccaccgcggcatcagt
tcctcctttcacgtaattacggggagcgacggctgtggggagagggcggactgggattcc
ctatcccgcttgaaaggcaccctgattttcctgatgggagtaaagaacctggaatcaatc
gtcagcaaccttttaaaatacggaaagccggcggacaccccggccgctatgatcatgtgg
ggtgccactcctgcccagaagacggtgacgggcactctggccgatatagtccgcagggtg
aaagaggcgggcatcaaaaacccggcggtttttgtcgtcggcggtacggttggcctgtgg
gagtatttaaactggtttgaggggaaacccctccacggccggaggatactggtgacggga
acaatcgacgcggaaaagggccaaccggaggacggcccctttgacttccttgaagacgcc
ggggccgaagtcatccactgccccaccgtaaaaatagagttcgattacggggaaacggcc
gggtttttagcaaatgcgggggacctaaaccttctcgtgtttacaagcaagaacgccgtt
acggcctttgccggagccatgaggcggatgaggctggacctgaggaggctcggcggtgct
acggtggcggcggtgggtaggaagacggcggaaagactcgaggaagtgtttatttacccc
gacctggtaccggaagaattcacttcaaaagacctgcttgaaaaaataccggccggtgga
ggcggtaaaaggaccgccgccgtcatcacctcggatatcggaggacaggaactcgtaggc
ggattggaggccaggggataccgggtaatgaaaatcgcagcctataaaaatctgcccaac
tacgacgtgagagagaggctcatcgaagaactgggaaaaggcgtggatgcggcggttttt
accagtccctcgtccttttaccgtatggagcaaatggtgggaaaactgcccgagaagctg
aaaaaagttttcatcgccgcgataggtccgacaacggcggcggccatagagaaaacggga
ttgaaagtggacgtatgtccaaaggagcatacgctggaagggctccaaaaggcccttcta
gagaaatttgttgggagaggtgaaggagatggaggtaataaaaaggcccaggagattgag
atataa

  All links  
No link information was found.   
DBGET integrated database retrieval system