KEGG   Thermosediminibacter oceani: Toce_0360Help
Entry
Toce_0360         CDS       T01289                                 

Definition
fructose-bisphosphate aldolase ;D-fructose 1,6-bisphosphatase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
toc  Thermosediminibacter oceani
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:toc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:toc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:toc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:toc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:toc00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:toc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
361600..362685
Genome map
AA seq 361 aa AA seqDB search
MSKITLTVIKADIGGYVGHCSVHPDLIEEAKSVLEEKGKGLLEDYVVTHVGDDINLIMTH
RKGVDNTEIHKLAWDTFLSCTQIAKKLKLYGAGQDLLSDSFSGNIKGMGPGVAEMEFEER
PSEPVIVFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHQGFKFEVLDTIENKKIVF
SCPEELYDLLVFLGAANRYAVKAVYSKSGEPAAVSSTQRMNLMAGRYVGKDDPVLIVRCQ
SGLPAVGEALEPFANPHLVAGWMRGSHFGPLMPVSCNGATPSRFDGPPRVVALGFQLAGG
KLVGPQDMFADVSFDRAREKALEMADYFRQLGPFEPHRLPLDEMEYTTLPQVMEKLKDRF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagataacattaacagttattaaagccgatatcggcggatatgtggggcactgc
agcgtacatcccgacctgatcgaagaagctaaaagcgttcttgaggaaaaaggaaaaggc
ttgctggaggactacgttgtaactcatgtaggtgatgacatcaacctcattatgacccac
aggaagggtgtagataatactgaaatccacaagctggcatgggacactttcctttcatgc
acccagattgcgaagaagctgaagctttacggggcaggacaggacctgttatccgattct
ttctcgggcaacataaagggaatggggccgggagttgcggaaatggaattcgaggaacgc
cccagcgaacccgtaatagttttcatggccgataagaccgagcctggagcatggaacctg
ccgctttacaagatgtttgccgacccgttcaacaccatcggccttgtgatagatcccaag
atgcatcaagggttcaagttcgaagttctggacactatagaaaataaaaagatcgtcttc
tcttgtccggaagagctttacgacctgctcgtatttttgggagccgcgaaccggtatgcg
gtcaaagccgtgtacagtaagagcggagaaccggccgccgtatcctccacgcagaggatg
aaccttatggccggcagatacgtgggcaaggatgaccccgtgcttatagttcgctgccag
agcggtttgcccgctgtgggagaggcactggaaccttttgccaacccgcacctggtggct
ggttggatgaggggctcgcacttcgggccgctgatgccggtatcctgcaacggtgcaacc
cccagcaggtttgacggtccgccgagggtggtggcgctggggttccagctggccggcggc
aagctggtaggtcctcaggacatgtttgcggatgtgtcctttgatagagcaagggaaaaa
gccttggaaatggccgattactttaggcaactaggcccctttgaaccccaccgcctcccg
ctggacgaaatggagtatacaaccctgcctcaggttatggaaaaactaaaggacaggttc
gaataa

DBGET integrated database retrieval system