KEGG   Thermosediminibacter oceani: Toce_0360Help
Entry
Toce_0360         CDS       T01289                                 

Definition
fructose-bisphosphate aldolase ;D-fructose 1,6-bisphosphatase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
toc  Thermosediminibacter oceani
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Toce_0360
   01230 Biosynthesis of amino acids
    Toce_0360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0360
   00030 Pentose phosphate pathway
    Toce_0360
   00051 Fructose and mannose metabolism
    Toce_0360
  Energy metabolism
   00680 Methane metabolism
    Toce_0360
Enzymes [BR:toc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Toce_0360
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Toce_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
361600..362685
Genome map
AA seq 361 aa AA seqDB search
MSKITLTVIKADIGGYVGHCSVHPDLIEEAKSVLEEKGKGLLEDYVVTHVGDDINLIMTH
RKGVDNTEIHKLAWDTFLSCTQIAKKLKLYGAGQDLLSDSFSGNIKGMGPGVAEMEFEER
PSEPVIVFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHQGFKFEVLDTIENKKIVF
SCPEELYDLLVFLGAANRYAVKAVYSKSGEPAAVSSTQRMNLMAGRYVGKDDPVLIVRCQ
SGLPAVGEALEPFANPHLVAGWMRGSHFGPLMPVSCNGATPSRFDGPPRVVALGFQLAGG
KLVGPQDMFADVSFDRAREKALEMADYFRQLGPFEPHRLPLDEMEYTTLPQVMEKLKDRF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagataacattaacagttattaaagccgatatcggcggatatgtggggcactgc
agcgtacatcccgacctgatcgaagaagctaaaagcgttcttgaggaaaaaggaaaaggc
ttgctggaggactacgttgtaactcatgtaggtgatgacatcaacctcattatgacccac
aggaagggtgtagataatactgaaatccacaagctggcatgggacactttcctttcatgc
acccagattgcgaagaagctgaagctttacggggcaggacaggacctgttatccgattct
ttctcgggcaacataaagggaatggggccgggagttgcggaaatggaattcgaggaacgc
cccagcgaacccgtaatagttttcatggccgataagaccgagcctggagcatggaacctg
ccgctttacaagatgtttgccgacccgttcaacaccatcggccttgtgatagatcccaag
atgcatcaagggttcaagttcgaagttctggacactatagaaaataaaaagatcgtcttc
tcttgtccggaagagctttacgacctgctcgtatttttgggagccgcgaaccggtatgcg
gtcaaagccgtgtacagtaagagcggagaaccggccgccgtatcctccacgcagaggatg
aaccttatggccggcagatacgtgggcaaggatgaccccgtgcttatagttcgctgccag
agcggtttgcccgctgtgggagaggcactggaaccttttgccaacccgcacctggtggct
ggttggatgaggggctcgcacttcgggccgctgatgccggtatcctgcaacggtgcaacc
cccagcaggtttgacggtccgccgagggtggtggcgctggggttccagctggccggcggc
aagctggtaggtcctcaggacatgtttgcggatgtgtcctttgatagagcaagggaaaaa
gccttggaaatggccgattactttaggcaactaggcccctttgaaccccaccgcctcccg
ctggacgaaatggagtatacaaccctgcctcaggttatggaaaaactaaaggacaggttc
gaataa

DBGET integrated database retrieval system