KEGG   Thermosediminibacter oceani: Toce_0377Help
Entry
Toce_0377         CDS       T01289                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
toc  Thermosediminibacter oceani
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Toce_0377
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Toce_0377
   00650 Butanoate metabolism
    Toce_0377
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Toce_0377
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Toce_0377
   00622 Xylene degradation
    Toce_0377
   00621 Dioxin degradation
    Toce_0377
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Toce_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
381002..381877
Genome map
AA seq 291 aa AA seqDB search
MDKIKVAVIGPGNIGSDLMYKILRSEYLCMEMMAGIVESEGIKRARSLGIRTTTEGIKPI
LEDESIKIVFDATGAKHHLKHAPLLKEAGKIAIDLTPAAVGPYVVPPVNLKDLHEEPNLN
MVTCGGQATVPIVYAINQVAGARYAEIVACIASKSAGQGTRQNIDEFTQTTAKALCAIGG
AKKSKAIIILNPADPPIIMTNTIYVDVENPDEKAIREAVDKMVRAVQSYVPGYRLRVPPI
LEGNKVTTIVEVEGAGDFLPKYAGNMDIITSAAVAVAEKLAARIMGKEAVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatcaaagttgccgtaataggtccgggcaacatcggttcggatttgatgtac
aaaatcctgcgcagcgaatacctctgtatggaaatgatggctggaatcgtggagtccgag
ggaatcaagagggctcgctccctgggaatccgcaccactaccgagggaataaagcccata
ctggaagatgaaagcataaaaatagtgtttgatgccacaggagccaaacaccacctgaaa
cacgctcccttgctgaaagaagccggtaaaattgccatcgaccttacgccggctgcggtg
gggccctatgtggtaccgccggtcaatctcaaagatttacatgaggagccaaacctcaac
atggtaacctgcggtggtcaggccaccgtgcccatagtttacgccatcaatcaggtggcc
ggcgcccgttatgcggaaatagtggcgtgcatagcgagcaaaagcgccgggcagggcacg
cggcagaacattgacgaatttacccagacgacggcaaaagccctttgtgccatcggcggg
gccaagaagagcaaggccattattattctaaatcctgccgacccacctatcatcatgacc
aacactatatacgtggatgtggaaaacccggacgaaaaagccatacgcgaagccgtcgat
aaaatggtcagggcagtccagagctatgtaccgggttaccggctgcgagtgccgcctatt
ctggagggaaataaagtaactaccatcgtcgaagtagaaggagcgggggatttcctgccc
aaatacgccggcaacatggatattataacgtcggcggcggtggcggtagccgagaaactg
gcggccagaattatggggaaggaggcagtggcgtga

DBGET integrated database retrieval system