KEGG   Thermosediminibacter oceani: Toce_0451Help
Entry
Toce_0451         CDS       T01289                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
  KO
K19071  
oxalate oxidoreductase subunit beta [EC:1.2.7.10]
Organism
toc  Thermosediminibacter oceani
Brite
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Toce_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(448122..449069)
Genome map
AA seq 315 aa AA seqDB search
MLEPITSLRKAPEEEYYLPGHRTCAGCGPALCYRLVAKAAGPNTIFVGPTGCMYVANTSY
GCGPWRVPWIHAQITNGGAVASGIEAAYKALIRKKKTDAEFPNIIVMAGDGGAVDIGLQA
LSGMLYRGHDVLFICYDNESYANTGIQTSPTTPYGAATTFTPPGPVVPEGKKLFPKDNPK
VVAHGHPELKYVATASIGWPVDLMNKVRKGLNQKGPAYLHIHAPCPKGWQFPANKTIEMA
KLAVETGMFQLYEYENGEYKLSVKIEKRKPVSEYMRLQGRFKHLKPEHIEKMQAFIDARC
AEVGLTVPVVTPKAK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacccattacttcattgcgtaaagcaccggaggaagaatattaccttcccgga
caccggacctgcgccggttgcggcccggctctatgctaccggctggtagccaaagccgcc
ggacccaacacaatattcgtaggcccgaccggctgcatgtatgtggccaatacgagctac
gggtgcggtccctggcgggtgccatggatccatgcccagataaccaacggcggagcggta
gcctcgggtatcgaggcggcttataaagcactgatccgcaagaaaaagaccgacgccgag
tttcccaacatcattgttatggccggcgacggcggtgcggttgatatcggacttcaggcg
ctttccggtatgctctaccgcggccacgacgtgctcttcatctgttacgacaatgaatct
tacgccaataccggcatccagacctcacccactacgccttacggtgcggcgacaaccttc
accccgcctggcccggtggttccggaaggcaagaaactgttccccaaagacaatcccaag
gtcgtcgcccacggacatccagagttaaagtatgtggcaactgcatcgatcggctggccc
gttgacctcatgaataaggttcggaaaggcctgaaccaaaaaggaccggcttacctgcat
attcatgcaccctgcccgaaaggctggcagttccctgccaacaagacaattgaaatggcg
aaactggccgttgagaccggcatgttccagctctatgaatacgaaaacggcgagtacaaa
ctttcggttaagattgaaaagcgcaaacccgtcagcgaatacatgcgcctgcagggccgg
ttcaagcacctgaagccagaacacattgaaaaaatgcaggccttcattgacgcgcgctgt
gcggaggtcggcctgaccgtccccgtagtaaccccgaaagcaaaataa

DBGET integrated database retrieval system