KEGG   Thermosediminibacter oceani: Toce_0480Help
Entry
Toce_0480         CDS       T01289                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
toc  Thermosediminibacter oceani
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Toce_0480
   00052 Galactose metabolism
    Toce_0480
   00500 Starch and sucrose metabolism
    Toce_0480
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_0480
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Toce_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
479066..479977
Genome map
AA seq 303 aa AA seqDB search
MKIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEEILIITGRNK
RAIEDHFDKSVELELELKKKGKGELLRVVEEISNMVDIHYVRQKEPRGLGHAIYCARTFV
GDEPFAVMLGDDVMCSKEPVLKQMMDIYERYNCSILGVQQVPEDDVSKYGIIDGAFIEDR
IYKVNNMIEKPKKQEAPSRMAIMGRYIITPRIFEILEHTKPGAGGEIQLTDALKELLNYE
VIYAYTFEGKRYDVGDKLGYLVATVEFALKREELRDEFRKYLLGLLAEDQAGYCEAAAGK
NSD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaaaaaagccgtcatacctgccgctggcctcggtacccggtttcttccggca
accaaggcccagcccaaagagatgctgccgatagtggataagcccactatccagtacata
gtggaagaagcggtggcctcgggcatcgaggaaatcctcataatcaccggcaggaacaag
cgggccatcgaagaccatttcgacaagtcggtggaactggagctggagctgaagaaaaag
ggaaaaggagaactattgagggtagtcgaggaaatatccaacatggtggacatccactac
gtccgccagaaggagccccgagggctggggcacgccatctactgcgccaggaccttcgtg
ggcgacgagcccttcgccgtcatgctgggcgacgatgttatgtgctcaaaggaaccggtg
ctgaaacagatgatggatatttacgagaggtataactgctcgatcctgggagtccagcag
gttccggaagacgacgtgagcaagtacggaattatagacggggcctttatcgaggaccgc
atctacaaggtcaacaacatgatcgaaaaaccgaaaaaacaggaagccccctcccgcatg
gcgataatggggaggtatatcataacccctcgcatatttgaaatcctggaacatacaaaa
ccaggggccgggggcgagatccagcttaccgatgcattaaaagaacttttaaactatgaa
gtaatctacgcctatacctttgaagggaaaagatacgacgtcggggacaagctggggtat
cttgtggctaccgtggaatttgccctgaaaagggaagaactccgggatgagtttagaaaa
tacctgctcggcctgctggcggaggatcaggccgggtactgcgaagcggctgcggggaaa
aattcggactga

DBGET integrated database retrieval system