KEGG   Thermosediminibacter oceani: Toce_0480Help
Entry
Toce_0480         CDS       T01289                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
toc  Thermosediminibacter oceani
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Toce_0480
   00052 Galactose metabolism
    Toce_0480
   00500 Starch and sucrose metabolism
    Toce_0480
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_0480
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Toce_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
479066..479977
Genome map
AA seq 303 aa AA seqDB search
MKIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEEILIITGRNK
RAIEDHFDKSVELELELKKKGKGELLRVVEEISNMVDIHYVRQKEPRGLGHAIYCARTFV
GDEPFAVMLGDDVMCSKEPVLKQMMDIYERYNCSILGVQQVPEDDVSKYGIIDGAFIEDR
IYKVNNMIEKPKKQEAPSRMAIMGRYIITPRIFEILEHTKPGAGGEIQLTDALKELLNYE
VIYAYTFEGKRYDVGDKLGYLVATVEFALKREELRDEFRKYLLGLLAEDQAGYCEAAAGK
NSD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaaaaaagccgtcatacctgccgctggcctcggtacccggtttcttccggca
accaaggcccagcccaaagagatgctgccgatagtggataagcccactatccagtacata
gtggaagaagcggtggcctcgggcatcgaggaaatcctcataatcaccggcaggaacaag
cgggccatcgaagaccatttcgacaagtcggtggaactggagctggagctgaagaaaaag
ggaaaaggagaactattgagggtagtcgaggaaatatccaacatggtggacatccactac
gtccgccagaaggagccccgagggctggggcacgccatctactgcgccaggaccttcgtg
ggcgacgagcccttcgccgtcatgctgggcgacgatgttatgtgctcaaaggaaccggtg
ctgaaacagatgatggatatttacgagaggtataactgctcgatcctgggagtccagcag
gttccggaagacgacgtgagcaagtacggaattatagacggggcctttatcgaggaccgc
atctacaaggtcaacaacatgatcgaaaaaccgaaaaaacaggaagccccctcccgcatg
gcgataatggggaggtatatcataacccctcgcatatttgaaatcctggaacatacaaaa
ccaggggccgggggcgagatccagcttaccgatgcattaaaagaacttttaaactatgaa
gtaatctacgcctatacctttgaagggaaaagatacgacgtcggggacaagctggggtat
cttgtggctaccgtggaatttgccctgaaaagggaagaactccgggatgagtttagaaaa
tacctgctcggcctgctggcggaggatcaggccgggtactgcgaagcggctgcggggaaa
aattcggactga

DBGET integrated database retrieval system