KEGG   Thermosediminibacter oceani: Toce_0573Help
Entry
Toce_0573         CDS       T01289                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
toc  Thermosediminibacter oceani
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:toc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
583359..583814
Genome map
AA seq 151 aa AA seqDB search
MPRAFIALGSNLGNREKNIVEAIERMKRRGIKILKMSGIIETEPYGYTKQDKFLNAACLV
ETELNPRDLMDALLEIENDMGRERKIRWGPRNIDLDLIFYEDLVIREEGLTIPHPDAHNR
PFVMGPIAEIDPDYRHPVLKKSVGEIYRTLL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccaagggcgttcatagccctgggcagcaacctggggaaccgggaaaagaacatcgtg
gaagccatcgagcggatgaagcggcgggggataaaaatcctgaagatgtccgggataatt
gaaacggagccttacgggtatacaaaacaggataaattcttgaacgctgcctgcctcgtt
gaaacggaactcaacccccgggatctgatggacgccctgctggaaatagagaacgacatg
ggccgggaaagaaaaatccgctgggggcccaggaacatagacctggacctgatattttac
gaggacctggtgataagggaagaaggcctcacaataccgcaccccgatgctcacaacagg
ccgttcgtaatggggccgattgccgaaatagaccccgattaccggcaccccgtcttgaaa
aaaagcgtaggggaaatatacaggacgttgctgtaa

DBGET integrated database retrieval system