KEGG   Thermosediminibacter oceani: Toce_0605Help
Entry
Toce_0605         CDS       T01289                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
toc  Thermosediminibacter oceani
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Toce_0605
Enzymes [BR:toc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Toce_0605
Peptidases [BR:toc01002]
 Cysteine Peptidases
  Family C44
   Toce_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
608236..609732
Genome map
AA seq 498 aa AA seqDB search
MYRIAGCLGGCDTEKVDNMLEGMLKEGSNQKKLYTSNNVTLGCNKSAMKDLGDFNQPLFN
EDHTIALVFDGEIYNYDELKAWLLSRGHEFKTDYDGEVLIHLYEELGSDMVSKLDGVFAF
AISGPEGFFAARDVLGARPLYYSEDKSGKMYFASEIKALLNIAENIREFPNGYYYTDKEG
FFQYDRICAAEVKESNLEKLVDDLDRRLNEAVKKRLMSDKPVGVFLSGGLDSSLIAAITR
QYVKGELHSFAVGVKGSDDLYYSQMVSDFLGTTHHVEEYSKEDVIDILPDVIYHLESFDP
ALVRGSVATYFAARLASRYVQVVLIGEGADELFGGYEYLKAPSVTNLTEELLTLINSLHN
TGFQRVERITAAHSIKARAPFLDREVINYAFSLDEKYKIYGEEKIEKWIVRKVAERYLPK
EIAWRKKAKFAHGTGTSGILSEWVKNDEVVKEAIDTDLAKIPSREERVYFSIFKKHFPNL
KNLELIGRTRSIVPKEIV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggatagccgggtgtctgggtggttgcgataccgaaaaagtggacaatatgctg
gaaggaatgttaaaagagggttctaatcaaaaaaagttatatacatcgaataatgttact
ttgggctgcaataaatcagcaatgaaagatttaggcgactttaatcaacccttgttcaac
gaagatcatactatagccttagtttttgacggagaaatatataattacgatgaactgaaa
gcgtggcttttgagcagaggccatgaatttaaaacggattacgacggtgaagtattgatc
catctttatgaagaattgggctccgatatggtgtccaaacttgatggtgtatttgctttt
gcgatatcgggtccggagggtttttttgcagccagagatgtgttgggagctaggcccttg
tattacagtgaagacaagagtggaaaaatgtattttgcttctgaaataaaagccttattg
aatatagctgaaaatataagggaatttccgaatggttattattataccgataaagagggc
ttttttcagtatgataggatttgtgccgcagaagtaaaagaatcgaatttagaaaaactg
gtggatgatttagacaggagattaaatgaagccgtgaagaaaaggctgatgtcggacaaa
cccgtaggtgtgtttctaagcggcggccttgattccagccttatcgctgcaattacaaga
caatacgtcaaaggagagcttcactcttttgcggtgggcgtaaaaggttccgatgatcta
tattattcgcaaatggtttccgatttcttgggtacaactcaccatgttgaagaatatagt
aaagaagatgtcatagatattttgccggacgtgatctaccatttagagtcctttgatccc
gccctggtaaggggctcggtggcgacgtattttgccgcccgccttgccagccggtacgtg
caggtagttttaatcggcgagggcgccgatgaactttttggcggatacgaatatctaaag
gcgccttcagttactaatttaacggaggaactccttactttgataaacagcctgcataat
acggggtttcaaagagtagaacgcatcaccgcagcccactcgattaaagcaagggcgccg
ttcctcgacagggaagttataaattacgctttttctctagatgaaaagtataagatatat
ggagaagaaaagattgaaaagtggattgtgcgcaaagttgctgaaaggtacctgcctaaa
gagatagcatggagaaagaaggccaaatttgcacacggaacgggaaccagcggaatatta
tccgaatgggtaaaaaacgatgaagtcgtgaaagaggcgatagatactgatttagccaaa
atacccagccgggaagaaagggtttacttcagcatctttaaaaagcatttccctaatttg
aaaaacttggagttaataggaaggacaagaagtatagttcctaaagaaatagtctag

DBGET integrated database retrieval system