KEGG   Thermosediminibacter oceani: Toce_0825Help
Entry
Toce_0825         CDS       T01289                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00030  Pentose phosphate pathway
toc00051  Fructose and mannose metabolism
toc00052  Galactose metabolism
toc00230  Purine metabolism
toc00500  Starch and sucrose metabolism
toc00520  Amino sugar and nucleotide sugar metabolism
toc00521  Streptomycin biosynthesis
toc01100  Metabolic pathways
toc01110  Biosynthesis of secondary metabolites
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0825
   00030 Pentose phosphate pathway
    Toce_0825
   00051 Fructose and mannose metabolism
    Toce_0825
   00052 Galactose metabolism
    Toce_0825
   00500 Starch and sucrose metabolism
    Toce_0825
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_0825
  Nucleotide metabolism
   00230 Purine metabolism
    Toce_0825
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Toce_0825
Enzymes [BR:toc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Toce_0825
    5.4.2.8  phosphomannomutase
     Toce_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ADL07588
JGI: Toce_0825
UniProt: D9S2G1
Position
complement(820312..821670)
Genome map
AA seq 452 aa AA seqDB search
MKRINPNIFRQYDIRGVVGEEIDEEVAQTLGRAFGTFALRNGEKKVVVGSDNRSSSPSLK
RALIEGLMSTGCDVVDPGTVVTPVFYFSRIHYGINPGIMVTASHNPPQYNGFKVAFGHAT
LYGDDIQKIRVMMEKGEFESGKGKLSYIDPTEDYISTICDKIELSKSLRVGIDCGNGTAS
LFAEKLFKRLGVETHPIYCESDPSFPNHFPDPVKPENLKDLRELVLREKLDLGIGFDGDG
DRIGVVDDTGTVIYGDMLMILYWREILPKHPGTTAIVEVKCSQALVEEIERLGGKPMFYK
TGHSLIKAKMKEIGAVFTGEMSGHMFFADEYYGFDDALYAAARLLRILSRTGKKLSELLS
DVPKYYSTPEIRVPCPDDEKFAKVEAIKEYFRKRYPMIDVDGARVLFPDGWGLVRASNTG
PELIVRCEAKTPEGLERIKEEMQKALNPLKAF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggataaaccccaacattttcaggcagtacgatataaggggcgttgtaggcgaa
gagatagatgaagaagtggcccaaaccctcgggcgggctttcggaaccttcgctctgaga
aacggcgagaaaaaggtcgtggtgggcagtgacaacagatcttcatcgccttctctaaaa
cgtgctttgatagaagggctgatgtccaccggatgcgatgtagtggacccggggacggtg
gtgactcctgtattctatttctccagaatacactacggcatcaatcccggtattatggta
accgccagccacaaccccccgcagtataacggttttaaggtggccttcgggcacgccacg
ctctacggcgacgacatccagaaaataagggtaatgatggaaaagggggagtttgaatca
ggaaaaggtaaactatcttatatagaccccaccgaagactacatttcaacaatatgcgat
aaaatcgagttatcaaaatccctaagggtgggtatcgactgcggcaacggcactgcatct
ttatttgcagaaaagttgttcaaacggctgggagttgaaacacacccgatctactgcgag
tcggatccctcctttcccaatcactttcctgacccggtgaagcccgaaaatttaaaagac
ctcagagagctggtgttgagggaaaagcttgatttgggcatcggttttgacggcgacggg
gaccgcataggcgtggtagacgacacaggaaccgtcatatacggggatatgctcatgatc
ctttactggcgggagatactgcctaaacatcccggcaccacagctatcgttgaagtaaag
tgctctcaagccttggtagaggaaatcgaaaggcttggcgggaagccaatgttctacaaa
actggccattctctgattaaagccaagatgaaagaaatcggcgccgttttcaccggcgaa
atgtcggggcacatgtttttcgccgatgaatattacggttttgacgatgccctgtacgca
gccgcccggctattaagaattctctcccgaaccggtaaaaaattatcagaattactatcc
gatgtaccgaaatattattcaacgccggaaatacgggtgccctgccccgacgacgaaaaa
ttcgcaaaggtggaagcgataaaggagtacttcaggaaaagatacccgatgattgacgtg
gatggtgccagggtgctctttcccgatggatggggcctggtcagggcctccaataccgga
cccgagctcatcgtgcgctgcgaagccaaaacccccgaaggcctggagagaataaaggaa
gagatgcagaaggccttaaaccctctcaaggcattttaa

DBGET integrated database retrieval system