KEGG   Thermosediminibacter oceani: Toce_0947Help
Entry
Toce_0947         CDS       T01289                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
toc  Thermosediminibacter oceani
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Toce_0947
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Toce_0947
Enzymes [BR:toc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Toce_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
938337..939794
Genome map
AA seq 485 aa AA seqDB search
MKVDQLLKNLSEIVDVKGSTEVEISSIAYDSRKVKKGGLFVAIKGFKLDGHDFIGQAINN
GAVVVIGEKEINLPEDVLYIKVKNSRKALSEASSLFFGKPAERLNVIGVTGTNGKTTTTY
LIKAILDEAGYSTGVVGTIGIRIKERLLPAERTTPESLELNEIFSEMVKEGVEYVTMEVS
SHSLKLHRVDHVKFEVGVFTNLTQDHLDFHVSFEDYYASKKKLFDLSRKAVINVDDESGE
RLCSELNIPVITYAIEKNADVRAENVVIGSDGVSYEVCAGGERRKITYKVPGRFSVYNSL
AAISACLSLGIDLETMAKALEKVRGVPGRFEPVDEGQDFTVIVDYAHTPDGLENVLNTVK
TFARGRIITVFGAGGDRDRGKRPLMGKVVSERSDYFIITSDNPRTEDPQAIIDDIEKGVT
ERSNYEKIIDRREAIRRAIEMALPGDVVLIAGKGHEDYQIIGDKVLHFDDREVAREFLRQ
KGRKR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagatcagttgttgaaaaacctcagcgaaattgtagatgtgaaaggttcgacg
gaagtcgagatcagcagcatcgcttatgattctcgtaaggtgaaaaaaggaggccttttc
gtggcaattaaaggttttaaacttgacggtcacgattttataggccaggcgattaacaac
ggagccgttgtggttataggggaaaaagaaatcaatttgcctgaagacgtgctttacata
aaagtcaaaaacagccgaaaagccctttccgaggcatcgtcgttgtttttcggaaaacct
gccgagaggttgaatgtgatcggtgttaccgggaccaacggcaagaccactacaacgtat
ctgatcaaagccatcctcgacgaggcgggatattccaccggagttgtaggtactataggc
ataaggatcaaggaaaggcttttaccggccgaacgcaccacgcccgaatctctggaattg
aacgaaattttttcagaaatggtaaaagagggagtggaatacgtaactatggaagtttca
tcccactccctaaagctgcacagggttgatcacgtaaaatttgaagtgggggttttcacc
aacctaactcaggatcacctggatttccatgtgagctttgaagattactacgcctccaaa
aagaaacttttcgatctttcgcgaaaagccgtgatcaacgtggacgacgagagcggcgag
cgcctttgtagtgaattgaatatcccagtaataacctatgctatcgaaaaaaacgccgat
gtgagggctgaaaacgtcgttatcggttcggacggagtttcttacgaagtatgtgccggt
ggtgaaagaaggaaaatcacatacaaagtaccgggtcgattcagcgtttacaattccctg
gccgcaatttccgcttgtctttctctggggattgacctggaaaccatggcaaaagctctg
gaaaaggtaagaggtgttcccggaaggtttgaaccagtagatgaaggtcaggattttaca
gttatcgtcgactacgcccatactcccgacggactggaaaatgtgttgaatacggttaag
acttttgccaggggtaggataattacggtttttggagcgggaggagaccgggatcggggg
aaaaggcctctgatgggaaaagtggtttccgaacgctcggattactttataattacctcc
gacaatccaaggaccgaagacccgcaggctattatagatgacatagagaaaggggtaacc
gaaaggagtaattacgaaaagataatcgatagaagggaagctatcagaagagctattgag
atggctttacccggtgatgtggttctgattgctgggaaaggccatgaagattatcagata
attggggataaggtcttacacttcgatgacagagaggtagccagagaatttttaagacag
aaggggagaaaacggtga

DBGET integrated database retrieval system