KEGG   Thermosediminibacter oceani: Toce_1165Help
Entry
Toce_1165         CDS       T01289                                 

Definition
(GenBank) peptidase M42 family protein
Organism
toc  Thermosediminibacter oceani
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M18 Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: ADL07923
JGI: Toce_1165
UniProt: D9S3E6
Position
1137980..1138993
Genome map
AA seq 337 aa AA seqDB search
MLLKELTEAFGVSGAEEEVRNILKREIEGLAKLRTDALGNLFFEKPGKDKKPKIMLAAHM
DEVGLMITSIGKNGWLKFDTVGGIDDRILVSKTVLIGPKKVKGVIGAKAIHLQEPKERET
ALKSKNLYIDIGAKDKEDAEKKVKVGDYAVFDSQFERIGDLIKAKALDDRVGCYIITEIL
KKNYDLTIAGAFTVQEEIGLRGSAVAAYAIEPDVAIVIEGTFAADVPENKEEGYSTTLDK
GPAVTLMDKTYIADRRLVDRVIQVAERKGIPCQLRRTAFGGTDAGRIHTTKEGIPTIVIS
VPCRYIHSPAGLASLTDIQNTIALIDALIIDFQERGL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggaattgacggaggctttcggcgtttccggagcagaggaagaggttaga
aatatccttaaacgtgaaatagaaggtctggcaaagctgaggaccgacgccctgggcaac
cttttctttgaaaaacccggaaaagataaaaaacctaagataatgctggccgcccatatg
gatgaagtcggccttatgatcacgtctataggtaaaaacggctggcttaagtttgacact
gttggtggaatagacgacaggatcctggtctcaaaaacggttctaataggtcctaagaag
gtgaaaggggttataggggcaaaagccatacatctgcaggaacctaaggaacgggaaaca
gcgttaaagtcaaagaatctatacatagatataggtgccaaagataaggaagatgcggaa
aaaaaggtcaaagtaggcgattatgccgttttcgattcccagtttgaacgcatcggtgat
ttgatcaaagcaaaagccctagatgacagggtaggctgctatataattaccgagatcctg
aaaaaaaattatgaccttactatcgctggtgcctttacagttcaggaagaaataggcctg
agaggttctgcagtggcagcttacgccatcgaacccgatgtggcgatcgttatagaaggg
acttttgccgccgacgtgcctgaaaacaaagaagaaggttatagtaccaccctagacaaa
ggacctgcagttaccctaatggacaaaacgtatatcgccgacaggcgactggtagataga
gtgattcaggttgcggaaagaaagggaattccctgccagctgcgcaggaccgcttttggt
ggtactgacgcaggtaggatacatacgacaaaagaaggcatacctacgatagtgatttcg
gtgccgtgccggtacatacattcacctgctgggttggcgagccttacggatatacaaaat
acaatagccttaatagacgccctcattatagattttcaggaaaggggtttatga

DBGET integrated database retrieval system