KEGG   Thermosediminibacter oceani: Toce_1166Help
Entry
Toce_1166         CDS       T01289                                 

Definition
(GenBank) Cellulase
Organism
toc  Thermosediminibacter oceani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1138990..1139973
Genome map
AA seq 327 aa AA seqDB search
MKMKELIKKLTETYGPSGEESKIREVIIDEIKDYVDEIRVDVLGNIIARKAGTGEKMMLA
AHMDEIGVIITNIDDKGFLRFSNIGGVSPFTLIGERVIFENGTVGVFGMEKLDSIKDLKF
NKMFIDIGARSKEEALKKVRLGDKAVYYRSCDIIGDCVTAKALDDRAGCAVLIRALQNLK
NPKFDTYFVFTVQEEVGLRGARTSAYGIEPDLAIAVDVTSTGDTPEAEKMAVELGKGPAV
KIMDRSVICHPKIKEMLIETAEKNNIPYQLEVLEWGGTDTGAIHLTKAGVPSGCLSIPTR
YIHTPSEVASIDDIEKATELLLRVLEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaagaattgataaaaaagctgaccgaaacttatggcccctcgggcgaagag
agcaaaatccgggaagttataatagatgaaataaaggactatgtcgatgagattcgcgtg
gatgtcctgggaaatataatcgcaagaaaagccgggacgggcgaaaagatgatgctggct
gcccacatggatgaaatcggcgttataatcacaaacattgacgacaaaggttttctcagg
ttttccaacatcggaggggtatcgccctttaccctaataggcgagagagttatttttgaa
aacgggaccgtaggtgttttcgggatggaaaaactggactcaataaaagatttgaagttc
aacaagatgttcatcgacatcggcgcgagatccaaagaagaagcgctaaagaaggtgcgc
ctgggagacaaggcggtctattacaggagctgcgatataatcggagattgcgtaacagcc
aaggccctggatgacagggcaggatgcgccgtactgatacgagctttgcagaatcttaaa
aatcctaagttcgatacctatttcgtgtttacggtacaggaagaagttggcctgcgtggt
gccagaacttcggcttacggaatagagccggatcttgccattgccgtagatgtgacgtca
accggagacacgcccgaagcggagaaaatggcggtggagctgggcaaaggacctgctgtg
aagataatggaccgatcggtgatttgtcatccgaagataaaggagatgctgatagagacc
gctgaaaaaaataatatcccctatcagttagaagtgctagaatggggcggaaccgatacg
ggagccattcaccttaccaaggccggagttccatccggttgtctttccataccgacaaga
tatatccacacgccatcggaagtggcttcaattgatgatatcgaaaaagcaacagaactg
ctgctacgcgttctggaaaaataa

DBGET integrated database retrieval system