KEGG   Thermosediminibacter oceani: Toce_1381Help
Entry
Toce_1381         CDS       T01289                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
toc  Thermosediminibacter oceani
Pathway
toc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:toc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Toce_1381
Enzymes [BR:toc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Toce_1381
DNA repair and recombination proteins [BR:toc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Toce_1381
    RecFOR pathway proteins
     Toce_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH HHH_2 HHH_8 HHH_3 DNA_pol_lambd_f Transposase_20 5_3_exonuc IMS_HHH Cdd1
Motif
Other DBs
NCBI-ProteinID: ADL08136
JGI: Toce_1381
UniProt: D9RXR2
Position
complement(1339637..1340215)
Genome map
AA seq 192 aa AA seqDB search
MLDYIRGRLRDIGPNFAILDVAGLGFRCFISLNTYNKIKLLKNSKVLLFTCLHVKEEGAE
LFGFSELHEREAFILLNKVSGVGPRVALSILSWLEPKRLKSVIMSEDVKTLTSVPGIGNK
TAQKIIFELKDKIKNLPVETVSQTEQAALCEARDALLALGFSIGEVQRVLNEIGTATTVE
EIISNALRLIAR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctggactacattagaggaaggttaagggatataggcccaaactttgcgatattggat
gtggctgggttggggttccgctgttttatatcgcttaatacgtacaataaaataaagctt
ttaaagaattcaaaagtattgctctttacgtgtctgcatgtaaaagaagagggagccgaa
cttttcgggttttcagaacttcacgagcgggaagcctttatactgttgaacaaggtatcc
ggcgtgggtccgagggtggctctttcgattctctcatggctggaaccgaagcgattgaaa
tccgtcataatgtccgaggatgtaaaaaccctcacatcggtaccgggcataggcaataaa
acggcccagaaaattatatttgaattaaaggataagataaaaaacctgccggtagaaacg
gtatcgcagaccgaacaggcagcgttatgtgaagccagggatgcgcttttagcccttgga
tttagtatcggcgaggttcagagggttttaaatgaaatcggaacagctacaaccgttgaa
gagataatttccaatgctttgaggctcattgcgagatag

DBGET integrated database retrieval system