KEGG   Thermosediminibacter oceani: Toce_1760Help
Entry
Toce_1760         CDS       T01289                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
toc  Thermosediminibacter oceani
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:toc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:toc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1760640..1762034)
Genome map
AA seq 464 aa AA seqDB search
MDVEKAIKLNEEPLIRSVCEILKIRSVEEDPAPGKPFGEGVAKALEYALDLADSFGLRTR
NLDNYIGWAEWGEGDEMVGILVHLDVVPEGKGWTYPPYGGEIHDGKIYGRGAIDNKGPAM
AALYALKTLKDAGVKFKRRVRVIFGTNEESGMKCINYYLEHDEAPTMGFSPDAEYPIING
EKGILTFSLKSDFEKCCGRKKAPTRLISLKGGQRPNMVPDYAEAVLRGDVAYLEEKFRAF
KEKSGYDMEFSTDGETVTVKSHGVSAHGSLPHKGKNAVMQLVAFLSELDLDNTAQEDFIR
FLNDKIGLDTTGKGLGVDVSDDLSGPLTFNVGIIRLDEKAGEVVINIRYPIKYKGEELLF
RIKENLAQGVRLEDVSDNPPHYVPEDSVIVQTLKEAYEKVTGEKAYCFSIGGGTYARMVK
NAVAFGPGFPGKPELAHEKDEYIEIEDLLKNLRIYTNVLLELVT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgaaaaagcgataaaattaaatgaggaaccccttataaggtcggtgtgtgaa
atacttaagataagaagcgtagaagaagatccggcgccgggaaaacctttcggagaaggt
gtagccaaggccctggagtacgccctggacctggccgacagtttcggtctgaggaccagg
aaccttgataattacataggttgggccgaatggggcgaaggcgacgaaatggtgggcata
ctggttcacctggacgtggtgccggaaggaaagggctggacttatccgccctacggcggg
gaaatccacgatgggaaaatttacggccggggtgccattgacaacaaagggcctgctatg
gcggcgctttatgcccttaaaactttaaaggatgcgggtgtcaaatttaagagaagggtc
cgggtgatattcggcaccaacgaagaaagcggtatgaaatgcataaattactacctggaa
cacgacgaggccccgacgatgggtttttcgcccgacgccgaatacccgataataaacgga
gaaaagggtattttgaccttctctttaaagagcgactttgagaaatgctgcggaaggaag
aaagcccctacgaggctgatctcacttaagggcggccaaaggccgaatatggtaccggat
tacgccgaagcggtattgaggggagacgtcgcctacctggaagagaagttcagagctttt
aaggaaaaatccggttacgacatggagttttccaccgatggggaaacggtgacggttaaa
tcccacggcgtttccgcccacggcagcctgccccacaaggggaagaacgctgttatgcag
cttgtggcgtttctttccgaactagacctcgataacaccgctcaggaggactttattcgc
ttcctgaacgacaaaattggactggataccaccggtaaggggttgggcgtcgatgtgtcg
gacgacttgtcgggcccgctgacgtttaacgtgggaatcatccgcctggacgaaaaggcc
ggggaagttgtaataaacatcaggtatccgataaaatataaaggagaagagctccttttc
aggataaaggaaaatctggcccaaggagtgcgtttagaagacgtatcggacaacccgccg
cattacgtgcctgaagacagcgtcatcgtccagaccctgaaggaggcttacgaaaaggtc
accggtgaaaaggcttactgtttttccatcggtggaggaacgtatgcacgcatggtgaaa
aatgcggtggccttcggaccaggctttccgggcaaaccagagctggcccatgaaaaggac
gagtatatagaaatcgaagacctcttgaaaaacctgaggatatatactaacgtgctgctg
gagctggtgacctga

DBGET integrated database retrieval system