KEGG   Thermosediminibacter oceani: Toce_1809Help
Entry
Toce_1809         CDS       T01289                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
toc  Thermosediminibacter oceani
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Toce_1809
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_1809
   00052 Galactose metabolism
    Toce_1809
   00500 Starch and sucrose metabolism
    Toce_1809
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_1809
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Toce_1809
   00524 Butirosin and neomycin biosynthesis
    Toce_1809
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Toce_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1814638..1815594)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVGIDLGGTKIATCAMDDDGNLLEKIELPTLAKEGPQKIIMRMKQSVYEILKRIDL
SLSDIAGIGIGVPGPMDAKRGLVKNPPNLPGWKDIPLLSIMKEEFNIPVIMENDANAAAI
AENLFGAGKGVKNFIYITISTGIGGGVITGGRIFKGGDGNAAEVGHVTINFEGPVCGCGN
SGCWEAYASGTALARFAREGILSGRKTRITDLAGQDEVRAEHVFAAAKEGDEFARELVEK
EGFYLGVGLANVVNAYNPERIAIGGGLTHAWDMFYSTMVEVMKTRALPANVENLEVMKAK
LGTDVGTIGAASLVFHKE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcagtgggtattgacctgggcggcactaaaatcgccacctgtgccatg
gacgatgacggaaacctccttgagaagatcgagcttcccacccttgcaaaggagggtccg
caaaagattatcatgcggatgaagcagagcgtttacgagatcctcaaaaggattgatttg
tctttgtccgacatagcgggcataggcataggagtgcccggcccgatggacgccaaaagg
gggctcgtcaaaaacccgcccaaccttccggggtggaaggatataccgctgctttcgatc
atgaaagaggagttcaatattcccgtcatcatggaaaacgacgccaacgcagcggcgatt
gcggaaaacctcttcggtgccgggaaaggcgtaaaaaactttatttacataaccatcagc
accggtataggagggggcgtcatcaccggcggcaggatttttaagggtggcgatggaaac
gccgcggaagtgggccatgtgacgataaatttcgaaggtcctgtatgcggctgcgggaac
tcgggctgctgggaagcgtatgcttccggcaccgcactggcgaggttcgccagggaaggc
attttatcgggcagaaagaccaggataactgatcttgccggacaggatgaggtaagagcc
gagcacgttttcgctgctgccaaagaaggggacgagtttgccagggaactggtggaaaaa
gagggcttttacctgggggtggggctggcaaatgtggtaaacgcctataatcccgagcgc
atcgcaatcggcggcggacttacccacgcctgggacatgttttattctacgatggtcgaa
gttatgaaaaccagggctctcccggctaatgtagagaatcttgaggtgatgaaggcaaag
ctgggaacggatgtgggcacaataggtgctgcatcgctggttttccataaggagtag

DBGET integrated database retrieval system