KEGG   Thermosediminibacter oceani: Toce_1809Help
Entry
Toce_1809         CDS       T01289                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00052  Galactose metabolism
toc00500  Starch and sucrose metabolism
toc00520  Amino sugar and nucleotide sugar metabolism
toc00521  Streptomycin biosynthesis
toc01100  Metabolic pathways
toc01110  Biosynthesis of secondary metabolites
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01200  Carbon metabolism
Module
toc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_1809
   00052 Galactose metabolism
    Toce_1809
   00500 Starch and sucrose metabolism
    Toce_1809
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_1809
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Toce_1809
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Toce_1809
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Toce_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ADL08540
JGI: Toce_1809
UniProt: D9RYW6
Position
complement(1814638..1815594)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVGIDLGGTKIATCAMDDDGNLLEKIELPTLAKEGPQKIIMRMKQSVYEILKRIDL
SLSDIAGIGIGVPGPMDAKRGLVKNPPNLPGWKDIPLLSIMKEEFNIPVIMENDANAAAI
AENLFGAGKGVKNFIYITISTGIGGGVITGGRIFKGGDGNAAEVGHVTINFEGPVCGCGN
SGCWEAYASGTALARFAREGILSGRKTRITDLAGQDEVRAEHVFAAAKEGDEFARELVEK
EGFYLGVGLANVVNAYNPERIAIGGGLTHAWDMFYSTMVEVMKTRALPANVENLEVMKAK
LGTDVGTIGAASLVFHKE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcagtgggtattgacctgggcggcactaaaatcgccacctgtgccatg
gacgatgacggaaacctccttgagaagatcgagcttcccacccttgcaaaggagggtccg
caaaagattatcatgcggatgaagcagagcgtttacgagatcctcaaaaggattgatttg
tctttgtccgacatagcgggcataggcataggagtgcccggcccgatggacgccaaaagg
gggctcgtcaaaaacccgcccaaccttccggggtggaaggatataccgctgctttcgatc
atgaaagaggagttcaatattcccgtcatcatggaaaacgacgccaacgcagcggcgatt
gcggaaaacctcttcggtgccgggaaaggcgtaaaaaactttatttacataaccatcagc
accggtataggagggggcgtcatcaccggcggcaggatttttaagggtggcgatggaaac
gccgcggaagtgggccatgtgacgataaatttcgaaggtcctgtatgcggctgcgggaac
tcgggctgctgggaagcgtatgcttccggcaccgcactggcgaggttcgccagggaaggc
attttatcgggcagaaagaccaggataactgatcttgccggacaggatgaggtaagagcc
gagcacgttttcgctgctgccaaagaaggggacgagtttgccagggaactggtggaaaaa
gagggcttttacctgggggtggggctggcaaatgtggtaaacgcctataatcccgagcgc
atcgcaatcggcggcggacttacccacgcctgggacatgttttattctacgatggtcgaa
gttatgaaaaccagggctctcccggctaatgtagagaatcttgaggtgatgaaggcaaag
ctgggaacggatgtgggcacaataggtgctgcatcgctggttttccataaggagtag

DBGET integrated database retrieval system