KEGG   Thermosediminibacter oceani: Toce_1948Help
Entry
Toce_1948         CDS       T01289                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
toc  Thermosediminibacter oceani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1960072..1963170
Genome map
AA seq 1032 aa AA seqDB search
MASKIIFNFDGDLPYQKDAINSVVGLFRGQDRELGDVIYRAKSRQIDLFENIVRNKLNIG
NNDILKNLREIQAQNMLFPSSELQPVYNFTIEMETGTGKTYVYLRTIFELYRDYNFLKFM
IVVPSVAIRKGVEKNIEILKDHFKALYNGLDISKYAFVYESNNLNKLLDFVEARDLRIVI
MNIQAFNKDSNKIRKEDETGRVLWELIKYTRPIVIIDEPQRLEGNGKKKSASLKAIEELD
PLFILRYSATHKKLYHQVYKLDSYQAYKQDLVKKIEVKTVYGSVSKDYPYVRYIEFTRDL
KAKIEIFYREAGGQVKLRTFNVQKGVSFYELSGELPQYRDMIVLEDPHKLNGLKIGHGDS
ILVLKEGENNYNLDELDIIRILIRLTIQTHFAKQLKILEKGYKIKVLSLFFIDRVKNFRD
NEAPDGRGIYARIFDEEYEKVIKDPRYNVLFKKYPDLFPEYQNVPKVREGYFARDKKNNE
TEIEDWDWEKDETEVKAKSQEDIERGIQLILEKKDELISFEEPLAFIFSHSALREGWDNP
NVFQLCTLKKGSSDIAKKQEIGRGLRLAVDIYGNRCFDKEVNVLTVIANDYYDHFAEALQ
KDFSQEAGLDREEVTFDVIYQTLADAGIPKELLGVNTVEAFRTELVNAGIINPKTNKLTK
DAAEIIYHEFSNQTFKPFQEAIKEKFVENMKAKGSKRIEIKNGDEEPVENGYHSFVTEKE
FQKLLKELRERINKKTIYKVKIDKEEFIKQSVEEINKHLVSKFIYRQYEVETGGIDFKKP
SEFEIKDPSRYTINLGTEEIKIIKSDFEIINYLMQQTFLPRKALIRIYSALENKILLQKQ
EILDEVIKIIQNKLKEFQVENIEYEVLDGFVFEEKNIFAVDEIEQWMLNESAKKAYKTKE
EYRKALQKYIRVESDGEYEFARSLDDDPDVLLFTKLKKGGLVIDTPYGNYTPDWAIIHKV
NDYTAKLYFIVESKFDKERVNLTDVEKAKIECARKHFASVASDVVFDWVNSYKKFKEVVN
RSIQKNSVQGGS
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaaaatcatatttaactttgacggtgatctaccatatcaaaaagatgccatt
aactctgtagtaggcctttttcggggacaagaccgggagcttggggatgtgatttaccgt
gcaaaaagcaggcaaatagatttgtttgaaaatattgtaagaaataagctaaatatcggg
aacaatgatattttgaaaaatttacgggaaatccaggcgcaaaatatgctgtttccgtca
tccgaactacaacctgtctataactttaccatcgaaatggaaacgggcaccggtaaaact
tacgtatatttgcggaccatctttgaactttatagagactataacttcttaaagtttatg
attgtcgtgccctcggtagccattcgcaaaggggttgaaaaaaacatcgaaatcctaaaa
gaccacttcaaagcactttataacggcctagacatatccaaatatgctttcgtctacgaa
tcgaataatttaaataagcttttagactttgttgaggcccgggacttaaggattgtcatt
atgaatatccaggctttcaacaaggatagcaataaaatccgaaaggaagatgaaaccgga
cgggttttgtgggaattaataaaatacaccaggccaattgtcataattgatgagccccag
aggctcgaaggaaacggtaaaaagaagagtgcatctttaaaagctattgaagaattagac
cctttatttattttaaggtattcagccacccataaaaaactatatcaccaggtatacaaa
cttgattcgtaccaggcttataaacaggatttagtaaagaaaatcgaagttaaaacagtt
tacggcagcgtcagtaaagactacccttatgtccgctatatcgaatttacccgggactta
aaagccaaaattgaaattttctatcgggaagccggcggtcaggttaaacttcgaaccttt
aacgtacaaaaaggtgttagcttttacgaattgtctggagaattaccccagtacagggat
atgattgtcctggaagatccccataaattaaatgggctgaagataggtcatggagacagc
atcttagtattaaaagagggagaaaacaattacaatctggacgaactcgatataatcaga
atattaattcgattgaccatccagacacatttcgcaaagcagctcaaaatcctcgaaaaa
ggttataaaattaaagtgttatcccttttcttcatcgaccgcgtaaaaaacttccgggac
aacgaggctcctgacggtcgaggaatatatgcgcggattttcgacgaagagtacgaaaaa
gtaattaaggacccccgatacaacgtactttttaaaaaatatccggatctgttccccgaa
taccagaacgttccaaaagtgagagaaggttattttgctcgggataaaaaaaataatgag
acagagatagaagactgggactgggaaaaagacgaaacggaggtaaaagctaagtcccag
gaagatattgaacggggaatacagcttatcttggaaaagaaagacgaattaatttctttc
gaggaaccattggctttcatcttttcccactcagccttaagggaaggctgggacaacccc
aatgtcttccagctatgcaccctgaaaaaaggaagttcggatattgcaaaaaaacaggag
attggacggggcctgcggctggcggtggatatctacggcaaccgatgctttgataaggaa
gtaaatgtcttgaccgttattgccaatgactattacgaccactttgccgaagcccttcag
aaagattttagccaggaagccgggcttgaccgggaagaagttacctttgatgttatttat
caaactcttgcagacgccggaataccgaaagaactgcttggggtaaacacggtggaagct
tttagaacggaacttgttaatgccgggattattaatcccaaaaccaacaagctaaccaaa
gatgcagcagaaattatttatcatgaattttccaatcaaacttttaagccttttcaggaa
gctattaaagaaaaattcgtagaaaatatgaaggcaaaaggtagtaaacgcatagaaatc
aaaaatggcgatgaagagccggtggaaaatggttatcacagcttcgtcaccgagaaagaa
ttccaaaaacttctaaaggaattaagggagagaataaacaagaaaacaatctataaagta
aaaattgataaggaagaatttatcaaacaaagtgtcgaagaaatcaacaaacatcttgtc
tcaaagtttatctaccggcaatatgaagtggaaaccggcggtatagattttaaaaagccc
agtgaatttgaaataaaagatccttctagatatacgattaatctcggaacagaagaaatt
aaaattattaaaagcgattttgagataataaattacctaatgcagcaaacttttttaccc
agaaaagctttaatcagaatttattcggctttagaaaataaaatcttactccaaaaacag
gaaattttagatgaagtgattaaaattattcaaaataaattaaaggaatttcaggttgag
aacatagaatatgaagttttggacgggtttgtatttgaagagaaaaatatatttgccgta
gatgaaatagagcaatggatgttaaatgaaagcgccaaaaaagcatataaaacaaaagaa
gaataccgaaaagccctccagaaatacatccgggtagaaagtgatggcgagtacgaattt
gcaagaagtcttgatgatgaccccgacgtcctgctctttacgaaattaaaaaagggagga
cttgttatcgataccccttacggaaattatactcccgactgggcaataattcataaagtt
aacgactatacggcaaagctatattttattgtggaatcaaaatttgataaagaaagggtt
aatttaactgatgtggaaaaagctaaaattgaatgcgcccgtaaacattttgccagcgta
gccagtgatgtggtctttgattgggttaatagttacaaaaaatttaaagaggtggtgaat
agaagtattcaaaaaaatagtgtccagggaggaagctaa

DBGET integrated database retrieval system