KEGG   Thermosediminibacter oceani: Toce_2016Help
Entry
Toce_2016         CDS       T01289                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00520  Amino sugar and nucleotide sugar metabolism
toc00550  Peptidoglycan biosynthesis
toc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Toce_2016
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Toce_2016
Enzymes [BR:toc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Toce_2016
Peptidoglycan biosynthesis and degradation proteins [BR:toc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Toce_2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Antimicrobial11
Motif
Other DBs
NCBI-ProteinID: ADL08737
JGI: Toce_2016
UniProt: D9RZW0
Position
complement(2029145..2030395)
Genome map
AA seq 416 aa AA seqDB search
MSSFIIEGGECLKGTVRTSSAKNAVLPVMAASLLAEGECVIEDVPELEDVRVMREVLSAL
GARCETKEGSLRIIPDNIDTCEAPYELVRKMRASFLVMGPLLAKYGWAKISLPGGCAIGS
RPIDLHLKGFTALGAEINLGHGSVEARCEKLKGSVIYLDFPSVGATENIMMAAALAEGQT
VIENAAKEPEIVDLANFLNSMGAYIRGAGTDVIKIEGVRNLKGISYTVIPDRIEAGTFLI
AGAITNGDVLVENVVSEHLKPLIAKLIECGAEVIEGEDGIRVVGRGRPNPVDVKTMPYPG
FPTDMQAQMMAYLSLCTGTSMVTETVFENRFMHVEELKRMGAKIKIEGKSAIVEGVEKLS
GAPVKATDLRAGAALILAGLAAEGTTEVMNAYHVDRGYENIVEKFQALGAKIKRAE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgagctttattatagaaggtggagagtgccttaaggggaccgtccggaccagcagt
gccaaaaacgccgtgcttcccgtaatggctgcttctctgctggcggagggcgagtgcgtg
atcgaagacgtccccgagcttgaagatgtcagggtgatgagggaagtgctttcggccctc
ggagccaggtgtgaaacaaaagagggttcgttaagaataattcccgataatatagatacc
tgtgaggccccttacgaacttgtgaggaaaatgagggcttcttttttggtgatgggtccg
ctgctggccaaatacggctgggccaagatatcgttgcccggcggctgtgccatcggtagc
cggcctattgacctgcacctgaaaggctttaccgccctgggggccgagataaacctgggg
cacggttccgtagaagccaggtgcgaaaagttgaagggcagcgtaatatacctggacttc
cccagcgtcggggccaccgagaatataatgatggcagccgctctggccgaagggcagacc
gtcatagaaaatgcggccaaggagccggaaatagtggacctggccaatttcctcaattcc
atgggggcttacataaggggtgcaggtaccgatgtaataaagatcgaaggcgtcaggaac
ctgaaggggatttcgtatacggttataccggaccggattgaggcgggtactttcctgatc
gccggagccattaccaacggagacgtgctggtggagaacgtggtgtccgaacacctgaag
ccccttattgccaagctcatcgagtgcggagctgaggtgatcgagggcgaggacggcata
agggttgtgggaaggggtagacccaatcccgtagatgtgaagacaatgccctatcccggc
tttcctaccgacatgcaggcgcagatgatggcttatctaagcctgtgcaccggcaccagc
atggtaaccgagaccgtttttgaaaaccgcttcatgcacgtggaggaattaaagcgcatg
ggcgcgaaaataaagatagagggcaagagcgctatagtagaaggggttgaaaaactttcc
ggtgctccggtgaaagccacagaccttcgagccggagccgcccttattctggcaggcctg
gcggctgaagggaccaccgaggtcatgaacgcctatcacgtggacagaggctacgaaaac
atagtggaaaaattccaagctttaggagcgaaaataaagagagccgaataa

DBGET integrated database retrieval system