KEGG   Thermosediminibacter oceani: Toce_2141Help
Entry
Toce_2141         CDS       T01289                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00020  Citrate cycle (TCA cycle)
toc00620  Pyruvate metabolism
toc00633  Nitrotoluene degradation
toc00640  Propanoate metabolism
toc00650  Butanoate metabolism
toc00680  Methane metabolism
toc00720  Carbon fixation pathways in prokaryotes
toc01100  Metabolic pathways
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01200  Carbon metabolism
Module
toc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_2141
   00020 Citrate cycle (TCA cycle)
    Toce_2141
   00620 Pyruvate metabolism
    Toce_2141
   00640 Propanoate metabolism
    Toce_2141
   00650 Butanoate metabolism
    Toce_2141
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Toce_2141
   00680 Methane metabolism
    Toce_2141
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Toce_2141
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Toce_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADL08855
JGI: Toce_2141
UniProt: D9S0J7
Position
complement(2145467..2146045)
Genome map
AA seq 192 aa AA seqDB search
MAKVMEIRWHARGGQGAKTAALMLAESVAAMGKYVQGFPEYGPERMGAPMLAFNRISDEP
IYIHSNVINPNVVIVLDPTLIGKAKITEGVPEDGIYIINTTKTPAEVREMLDIKGGKIYT
LDANQISLDTIGRAIPNTPMMGAFIRATGIIPFDQFMSHIKELLSKKFKTKPEVVEGNLK
AIERAYREVKEE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtgatggaaatccgctggcatgctagaggcggccagggggcaaagacggcg
gctcttatgttggccgaatcggtagcagcaatgggcaagtacgtccagggctttccagag
tacggacccgaaagaatgggcgctcccatgctggcttttaacaggatcagcgacgaaccc
atttacattcactccaacgttataaaccccaatgttgtaatagtgctggatcccaccctg
ataggaaaagccaagataaccgaaggggtgccggaggacggtatctacatcatcaacacc
accaagacccccgcggaagtaagggagatgctggatataaagggtggcaagatttatacc
ctggatgccaaccagatatcgctggataccatagggagggccattcccaatactcccatg
atgggagcttttatcagggcgacgggcatcatacccttcgaccaatttatgagccacata
aaggaactgctttccaaaaagttcaagacaaagcccgaagttgtcgagggtaaccttaag
gcgatagagagggcttaccgggaggtgaaggaggaatga

DBGET integrated database retrieval system