KEGG   Thermosediminibacter oceani: Toce_2184Help
Entry
Toce_2184         CDS       T01289                                 

Definition
arginyl-tRNA synthetase (EC:6.1.1.19)
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
toc  Thermosediminibacter oceani
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:toc00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2187914..2189620)
Genome map
AA seq 568 aa AA seqDB search
MKDVKAQIQDKLKELTVSALKKAVDDGVINLTKIPEFNIEVPQAEAHGDFAANVAMTAAR
EAKMPPRKIAEIIKERMEISGTGIERIEVAGSGFINFYLSPTWAHGVIPVILSEGDAYGR
QDIGKGKKVQVEFVSANPTGPMHMGNARGAALGDALASVLEMAGYDVTREFYINDAGNQI
ENFGLSLEARYLELLGLEGRIPEGGYHGEDIKDHMRELIEKEGDRFLHVDPAERRAYFIE
YALKKNIDRMKRDLENFGVHFDVWFSERSLHDEGKVQEVIRLLTERGYTYEKDGALWFKA
TEFGVPKDEVLVRQNGIPTYFASDIAYHKDKFDRGFEWVIDIWGADHHGHVARMKGALAA
LGYDPEKLTIIIMQLVRLYRNGEIARMSKRTGRAVTLADLVEEVGKDAARFFFNLRGADT
HLDFDLDLAVKQSEENPVYYVQYAHARISSIFRQAAEQGVAVPEVRDRSPEDLEKLLSKL
TDETEIQLIKKLADFPGEIRVAASTLSPYRIANYTLELAAAFHSFYNVCRVLTDDPDLTA
ARLMLVKAVQQVLRNAFRILGISAPDRM
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgtcaaggcacagatacaggataagctgaaggaactgacggtgtccgctctc
aagaaggccgttgacgacggggtcataaacctcactaaaataccggaattcaacatagag
gtgcctcaggctgaagcccacggcgattttgcggccaatgtggcgatgacggcggcgagg
gaggcgaaaatgccgcccagaaagatcgcagagataataaaggagcgaatggaaatctcc
ggtaccggcatagagaggatcgaagtggctggatcgggatttataaatttttacctttcc
cccacctgggcccacggtgtaatcccggtaattctaagcgaaggcgacgcttacggtcgc
caggatatcgggaagggcaaaaaggtgcaggtggagttcgtcagcgccaacccaactggc
cccatgcacatgggcaacgccaggggagccgcgctgggggacgccctggcgtcggtgctg
gaaatggccggctacgacgtcaccagggaattttatataaacgatgccggaaaccagatt
gaaaacttcgggctctcgctggaggcaagatacctggagcttctgggcttagaaggtcga
attcccgaagggggataccacggggaggacataaaagaccacatgcgggaactgatagag
aaggaaggcgaccgcttcctccacgtggacccggccgaaaggagagcctattttatagag
tatgccctgaaaaagaacatagatcgcatgaaacgggaccttgaaaacttcggcgtccac
tttgacgtatggttttccgaaaggagccttcacgatgaaggcaaggtgcaagaggtcatc
aggctccttacggaacggggatatacctacgaaaaggacggagcattgtggtttaaagcg
acggaattcggagtgcccaaggacgaggtgctcgtaaggcagaacggaatacccacgtat
ttcgcttcggacatagcttaccacaaggataaattcgaccgggggtttgaatgggtcata
gacatctggggagccgaccatcacggtcacgtggccaggatgaagggagccctggcggct
ctcggttacgacccggaaaaactcaccattataataatgcagctggttcggctttacagg
aacggcgaaatcgcgcgcatgtccaaacgcaccggtcgggcggtgacgctggcggacctg
gtggaagaagtagggaaggatgctgcccggttcttcttcaacctgaggggtgccgatacc
cacctggatttcgacctggacctggcggtcaagcagtcggaggaaaacccggtatactac
gtccagtacgcccacgcgcgcatttctagcatcttcaggcaggccgccgagcagggcgtt
gccgtgcccgaggtccgggataggtcccccgaagaccttgagaagctcctttccaagctg
accgatgaaaccgagatccagcttattaagaaactcgctgatttcccgggggagataagg
gtagctgcatccaccctttcgccctaccgcatagccaattacacgctggaactggcagcc
gcttttcactccttttacaacgtatgccgcgtgctgaccgacgacccggacctgaccgca
gcaaggctcatgctggtaaaggcggtgcagcaggtcctgaggaacgccttcaggatcctg
ggcatttccgccccagatcggatgtag

DBGET integrated database retrieval system