KEGG   Thalassolituus oleivorans MIL-1: TOL_2032Help
Entry
TOL_2032          CDS       T02529                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TOL_2032
Enzymes [BR:tol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TOL_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2150189..2150740
Genome map
AA seq 183 aa AA seqDB search
MSNLETLYQQVLSELGEDTNREGLLDTPKRAAKAMQFLTSGYETNLHEVVNNAVFTSDND
EMVVVQGIEFYSLCEHHMLPFIGRCHIGYLPNGNVLGLSKFARITDMFARRLQIQENMTK
QIAEAVEEITGCRGVGVIVEAQHMCMMMRGVQKQNSMMRTSVMKGAFRENQATRDEFMRL
VGL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcttgaaaccctgtaccaacaggtcctctctgaattaggcgaggatacaaat
cgcgaaggcttgctagacactccgaaacgcgccgccaaagccatgcagtttctaacaagc
ggctatgagaccaatctccatgaagtcgtcaacaatgccgtattcaccagcgataatgac
gaaatggtcgtggtacaaggcattgaattttattcgctgtgcgaacatcacatgttgcca
tttatcgggcgttgccatattggttatctacccaacggaaatgtactaggcctatctaag
ttcgctcgtattaccgatatgtttgcccgtcgcttacaaatccaagaaaatatgaccaaa
caaatcgccgaagcagtcgaagaaattaccggctgtcgtggtgtcggtgttattgtcgaa
gcgcaacacatgtgtatgatgatgcgaggagtgcaaaagcaaaactctatgatgcgcacg
tctgtcatgaaaggcgcattccgcgaaaatcaagctacgcgtgacgagttcatgcgttta
gttggtctgtaa

DBGET integrated database retrieval system